Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW1BFMQ)

• DOT Name: C-type lectin domain family 18 member B (CLEC18B)
• Synonyms: Mannose receptor-like protein 1
• Gene Name: CLEC18B
• Related Disease:
  Adult glioblastoma
  Advanced cancer
  Glioblastoma multiforme
• UniProt ID: CL18B_HUMAN
• Pfam ID: PF00188 ; PF00059
• Sequence:
  MLHPETSPGRGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
  WVQPPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASF
  VEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVC
  AYSPGGNWEVNGKTIIPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHG
  RLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFH
  TCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVI
  DSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGLVWLSAAMGFGNCVEL
  QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS
• Function: Binds polysaccharides in a Ca(2+)-independent manner.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of C-type lectin domain family 18 member B (CLEC18B).	[2]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of C-type lectin domain family 18 member B (CLEC18B).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of C-type lectin domain family 18 member B (CLEC18B).	[4]

References

• [1] Overexpression of CLEC18B Associates With the Proliferation, Migration, and Prognosis of Glioblastoma.ASN Neuro. 2018 Jan-Dec;10:1759091418781949. doi: 10.1177/1759091418781949.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.