Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW351LV)

DOT Name Fer3-like protein (FERD3L)
Synonyms Basic helix-loop-helix protein N-twist; Class A basic helix-loop-helix protein 31; bHLHa31; Nephew of atonal 3; Neuronal twist
Gene Name FERD3L
Related Disease
Triple negative breast cancer ( )
Epilepsy, idiopathic generalized ( )
Intellectual disability ( )
UniProt ID
FER3L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00010
Sequence
MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG
Function
Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Triple negative breast cancer DISAMG6N Strong Biomarker [1]
Epilepsy, idiopathic generalized DISODZC9 Limited Biomarker [2]
Intellectual disability DISMBNXP Limited Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Fer3-like protein (FERD3L). [3]
------------------------------------------------------------------------------------

References

1 A two-gene epigenetic signature for the prediction of response to neoadjuvant chemotherapy in triple-negative breast cancer patients.Clin Epigenetics. 2019 Feb 20;11(1):33. doi: 10.1186/s13148-019-0626-0.
2 Saethre-Chotzen phenotype with learning disability and hyper IgE phenotype in a patient due to complex chromosomal rearrangement involving chromosomes 3 and 7.Am J Med Genet A. 2012 Jul;158A(7):1680-5. doi: 10.1002/ajmg.a.35367. Epub 2012 May 24.
3 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.