Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWEW67K)

• DOT Name: T-complex protein 10A homolog 1 (TCP10L)
• Synonyms: T-complex protein 10A-1; TCP10A-1; TCP10-like
• Gene Name: TCP10L
• Related Disease:
  Hepatocellular carcinoma
  Neoplasm
• UniProt ID: TCP1L_HUMAN
• Sequence:
  MLAGQLEARDPKEGTHPEDPCPGAGAVMEKTAVAAEVLTEDCNTGEMPPLQQQIIRLHQE
  LGRQKSLWADVHGKLRSHIDALREQNMELREKLRALQLQRWKARKKSAASPHAGQESHTL
  ALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSSSNNSAPPKPMSLKIERISSWKT
  PPQENRDKNLSRRRQDRRATPTGRPTPCAERRGGV
• Function: May be involved in transcriptional regulation. Has in vitro transcription inhibition activity. Acts as a tumor suppressor in hepatocellular carcinoma (HCC) cells.
• Tissue Specificity: Expressed in liver and testis. Expressed in the seminiferous tubules (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of T-complex protein 10A homolog 1 (TCP10L).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of T-complex protein 10A homolog 1 (TCP10L).	[6]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of T-complex protein 10A homolog 1 (TCP10L).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of T-complex protein 10A homolog 1 (TCP10L).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of T-complex protein 10A homolog 1 (TCP10L).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of T-complex protein 10A homolog 1 (TCP10L).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of T-complex protein 10A homolog 1 (TCP10L).	[8]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of T-complex protein 10A homolog 1 (TCP10L).	[9]

References

• [1] TCP10L acts as a tumor suppressor by inhibiting cell proliferation in hepatocellular carcinoma.Biochem Biophys Res Commun. 2014 Mar 28;446(1):61-7. doi: 10.1016/j.bbrc.2014.02.049. Epub 2014 Feb 21.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [9] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.