General Information of Drug Off-Target (DOT) (ID: OTWXGQMU)

DOT Name Complement factor H-related protein 4 (CFHR4)
Synonyms FHR-4
Gene Name CFHR4
Related Disease
Atypical hemolytic uremic syndrome ( )
Glycogen storage disease type II ( )
Systemic lupus erythematosus ( )
Age-related macular degeneration ( )
UniProt ID
FHR4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00084
Sequence
MLLLINVILTLWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF
VTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDVEIENGFISESSSIYILNEETQYNCKPG
YATAEGNSSGSITCLQNGWSTQPICIKFCDMPVFENSRAKSNGMWFKLHDTLDYECYDGY
ESSYGNTTDSIVCGEDGWSHLPTCYNSSENCGPPPPISNGDTTSFPQKVYLPWSRVEYQC
QSYYELQGSKYVTCSNGDWSEPPRCISMKPCEFPEIQHGHLYYENTRRPYFPVATGQSYS
YYCDQNFVTPSGSYWDYIHCTQDGWLPTVPCLRTCSKSDIEIENGFISESSSIYILNKEI
QYKCKPGYATADGNSSGSITCLQNGWSAQPICIKFCDMPVFENSRAKSNGMRFKLHDTLD
YECYDGYEISYGNTTGSIVCGEDGWSHFPTCYNSSEKCGPPPPISNGDTTSFLLKVYVPQ
SRVEYQCQSYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYA
KTGDTIEFMCKLGYNANTSVLSFQAVCREGIVEYPRCE
Function Involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
Tissue Specificity Expressed by the liver and secreted in plasma.
KEGG Pathway
Complement and coagulation cascades (hsa04610 )
Reactome Pathway
Regulation of Complement cascade (R-HSA-977606 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Atypical hemolytic uremic syndrome DIS6FUDJ Strong Biomarker [1]
Glycogen storage disease type II DISXZPBC Strong Biomarker [2]
Systemic lupus erythematosus DISI1SZ7 Strong Genetic Variation [3]
Age-related macular degeneration DIS0XS2C moderate Genetic Variation [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Complement factor H-related protein 4 (CFHR4). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Complement factor H-related protein 4 (CFHR4). [6]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Complement factor H-related protein 4 (CFHR4). [7]
------------------------------------------------------------------------------------

References

1 Hemolytic Uremic Syndrome in an Infant with Primary Hyperoxaluria Type II: An Unreported Clinical Association.Nephron. 2019;142(3):264-270. doi: 10.1159/000497823. Epub 2019 Mar 19.
2 The NEI/NCBI dbGAP database: genotypes and haplotypes that may specifically predispose to risk of neovascular age-related macular degeneration.BMC Med Genet. 2008 Jun 9;9:51. doi: 10.1186/1471-2350-9-51.
3 Association of genetic variants in complement factor H and factor H-related genes with systemic lupus erythematosus susceptibility.PLoS Genet. 2011 May;7(5):e1002079. doi: 10.1371/journal.pgen.1002079. Epub 2011 May 26.
4 Genome-Wide Association Study Reveals Variants in CFH and CFHR4 Associated with Systemic Complement Activation: Implications in Age-Related Macular Degeneration.Ophthalmology. 2018 Jul;125(7):1064-1074. doi: 10.1016/j.ophtha.2017.12.023. Epub 2018 Feb 2.
5 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
6 Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
7 Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.