Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX24W0H)

• DOT Name: Uncharacterized protein C10orf67, mitochondrial (C10ORF67)
• Gene Name: C10ORF67
• Related Disease:
  Brain cancer
  Sarcoidosis
• UniProt ID: CJ067_HUMAN
• Pfam ID: PF15821 ; PF15852
• Sequence:
  MMALVRDRRAHYVMSIVIRWVHCFSSSLRGTFGTRWEAMKAKATELRVCCARRKREAREF
  KPPQMRGSTRLNISDDLKIGFFSTDHATQTDSSEILSVKELSSSTQKLAQMMKSLQVDFG
  FLKQLLQLKFEDRLKEESLSLFTILHDRILEIEKHYQQNEDKMRKSFNQQLADAIAVIKG
  MYQQFFEVEEENVSLQDASTVKTNILLRKLKEKEEVIKELKEELDQYKDFGFHKMESFAK
  ETSSPKSNLEKENLEYKVENERLLQIISELEEEIQINLKENSGLEDELISMKEMAEKDHK
  TIQKLMDSRDRLREELHYEKSLVQDVINKQKEDKEMRKKYGSLSVKVARSAKGREASLSP
  WPKSPPSTTALRPHSATMSVSSAGAQKAKMPKKALKEDQAVVEDKHGLESQIEALKANLE
  NEKKKVERFRKEADRLNKSWEKRFFILRNSFHVLKNEMFTRHTLFRQFAVLADTSFNYIK
  VKPLLVQSRTTMTAISSSSHCTSSIDGKHVDVVSDQAALQLSPKGKLSESPKEESLEEPS
  MRQSSPAETVD

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Brain cancer	DISBKFB7	Strong	Genetic Variation	[1]
Sarcoidosis	DISE5B8Z	Strong	Genetic Variation	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Uncharacterized protein C10orf67, mitochondrial (C10ORF67).	[3]
Propofol	DMB4OLE	Approved	Propofol increases the expression of Uncharacterized protein C10orf67, mitochondrial (C10ORF67).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Uncharacterized protein C10orf67, mitochondrial (C10ORF67).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Uncharacterized protein C10orf67, mitochondrial (C10ORF67).	[5]

References

• [1] Identification of a novel, recurrent MBTD1-CXorf67 fusion in low-grade endometrial stromal sarcoma.Int J Cancer. 2014 Mar 1;134(5):1112-22. doi: 10.1002/ijc.28440. Epub 2013 Sep 4.
• [2] Fine-mapping in African-American women confirms the importance of the 10p12 locus to sarcoidosis.Genes Immun. 2012 Oct;13(7):573-8. doi: 10.1038/gene.2012.42. Epub 2012 Sep 13.
• [3] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [4] Propofol suppresses proliferation, migration, invasion, and tumor growth of liver cancer cells via suppressing cancer susceptibility candidate 9/phosphatase and tensin homolog/AKT serine/threonine kinase/mechanistic target of rapamycin kinase axis. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271211065972. doi: 10.1177/09603271211065972.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.