Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXC3EYH)

DOT Name Leucine zipper protein 4 (LUZP4)
Synonyms Cancer/testis antigen 28; CT-28; CT28; Tumor antigen HOM-TES-85
Gene Name LUZP4
Related Disease
Testicular cancer ( )
UniProt ID
LUZP4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDDIIIYKELEGTNAEEEKNKRQNHSKKESP
SRQQSKAHRHRHRRGYSRCRSNSEEGNHDKKPSQKPSGFKSGQHPLNGQPLIEQEKCSDN
YEAQAEKNQGQSEGNQHQSEGNPDKSEESQGQPEENHHSERSRNHLERSLSQSDRSQGQL
KRHHPQYERSHGQYKRSHGQSERSHGHSERSHGHSERSHGHSERSHGHSKRSRSQGDLVD
TQSDLIATQRDLIATQKDLIATQRDLIATQRDLIVTQRDLVATERDLINQSGRSHGQSER
HQRYSTGKNTITT
Function
Export adapter involved in mRNA nuclear export in cancer cells. Binds and enhances the RNA-binding activity of the nuclear RNA export factor NXF1. Can restore mRNA export function in cells compromised by loss of mRNA export adapters.
Tissue Specificity Expressed specifically in testis. Also expressed in a wide variety of cancer types, but particularly high levels of expression observed in melanoma cells.
Reactome Pathway
mRNA 3'-end processing (R-HSA-72187 )
RNA Polymerase II Transcription Termination (R-HSA-73856 )
Transport of Mature mRNA derived from an Intron-Containing Transcript (R-HSA-159236 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Testicular cancer DIS6HNYO Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Leucine zipper protein 4 (LUZP4). [2]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Leucine zipper protein 4 (LUZP4). [3]
------------------------------------------------------------------------------------

References

1 Prospective study on the expression of cancer testis genes and antibody responses in 100 consecutive patients with primary breast cancer.Int J Cancer. 2006 Feb 1;118(3):696-703. doi: 10.1002/ijc.21352.
2 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
3 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.