Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXOSGIB)

DOT Name	NKG2-F type II integral membrane protein (KLRC4)
Synonyms	NK cell receptor F; NKG2-F-activating NK receptor
Gene Name	KLRC4
Related Disease	Behcet disease ( ) Small lymphocytic lymphoma ( ) Chronic hepatitis B virus infection ( )
UniProt ID	NKG2F_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYH CKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHC PEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
Function	May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Tissue Specificity	Natural killer cells.
KEGG Pathway	Antigen processing and presentation (hsa04612 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Behcet disease	DISSYMBS	Strong	Genetic Variation	[1]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[2]
Chronic hepatitis B virus infection	DISHL4NT	moderate	Genetic Variation	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of NKG2-F type II integral membrane protein (KLRC4).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of NKG2-F type II integral membrane protein (KLRC4).	[5]
------------------------------------------------------------------------------------

References

1	Genetic polymorphisms of C-type lectin receptors in Behcet's disease in a Chinese Han population.Sci Rep. 2017 Jul 13;7(1):5348. doi: 10.1038/s41598-017-05877-x.
2	Scan of 977 nonsynonymous SNPs in CLL4 trial patients for the identification of genetic variants influencing prognosis.Blood. 2008 Feb 1;111(3):1625-33. doi: 10.1182/blood-2007-08-110130. Epub 2007 Nov 15.
3	Association of NKG2D genetic polymorphism with susceptibility to chronic hepatitis B in a Han Chinese population.J Med Virol. 2010 Sep;82(9):1501-7. doi: 10.1002/jmv.21855.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.