Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXS0PFW)

• DOT Name: Putative nuclease HARBI1 (HARBI1)
• Synonyms: EC 3.1.-.-; Harbinger transposase-derived nuclease
• Gene Name: HARBI1
• UniProt ID: HARB1_HUMAN
• EC Number: 3.1.-.-
• Pfam ID: PF13359
• Sequence:
  MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRP
  TQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIR
  FPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVC
  DIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHI
  PETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHN
  ISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
• Function: Transposase-derived protein that may have nuclease activity (Potential). Does not have transposase activity.
• Tissue Specificity: Detected in brain, eye, nerve tissue, kidney and lung.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Putative nuclease HARBI1 (HARBI1).	[1]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Putative nuclease HARBI1 (HARBI1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Putative nuclease HARBI1 (HARBI1).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Putative nuclease HARBI1 (HARBI1).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Putative nuclease HARBI1 (HARBI1).	[5]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Putative nuclease HARBI1 (HARBI1).	[6]

References

• [1] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [4] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [6] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.