Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXSGOQE)

DOT Name Profilin-3 (PFN3)
Synonyms Profilin III
Gene Name PFN3
Related Disease
Parkinson disease ( )
UniProt ID
PROF3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00235
Sequence
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA
Function
Binds to actin and affects the structure of the cytoskeleton. Slightly reduces actin polymerization. Binds to poly-L-proline, phosphatidylinositol 3-phosphate (PtdIns(3)P), phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) and phosphatidylinositol 4-phosphate (PtdIns(4)P). May be involved in spermatogenesis.
Tissue Specificity Testis specific.
KEGG Pathway
Rap1 sig.ling pathway (hsa04015 )
Regulation of actin cytoskeleton (hsa04810 )
Amyotrophic lateral sclerosis (hsa05014 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Parkinson disease DISQVHKL Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Profilin-3 (PFN3). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Profilin-3 (PFN3). [4]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Profilin-3 (PFN3). [3]
------------------------------------------------------------------------------------

References

1 Pluronic gel-based burrowing assay for rapid assessment of neuromuscular health in C. elegans.Sci Rep. 2019 Oct 23;9(1):15246. doi: 10.1038/s41598-019-51608-9.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.