Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY7IG2V)

• DOT Name: Oxysterol-binding protein-related protein 9 (OSBPL9)
• Synonyms: ORP-9; OSBP-related protein 9
• Gene Name: OSBPL9
• Related Disease:
  Cerebral infarction
  Hyperlipidemia, familial combined, LPL related
• UniProt ID: OSBL9_HUMAN
• Pfam ID: PF01237 ; PF00169
• Sequence:
  MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGI
  DDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHTLQLQGLDSGFVPSVQDFD
  KKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIA
  KDQSNAEKHADGMISTINPVDAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLP
  VGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE
  FHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRD
  DDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSI
  SDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVS
  EGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIG
  QGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGG
  KKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQ
  NEYESRSLWKDVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGEC
  WVYDEPLLKRLGAAKH
• Tissue Specificity: Widely expressed.
• Reactome Pathway: Synthesis of bile acids and bile salts (R-HSA-192105)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cerebral infarction	DISR1WNP	Strong	Genetic Variation	[1]
Hyperlipidemia, familial combined, LPL related	DISL1CE3	Strong	Genetic Variation	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Oxysterol-binding protein-related protein 9 (OSBPL9).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Oxysterol-binding protein-related protein 9 (OSBPL9).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Oxysterol-binding protein-related protein 9 (OSBPL9).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Oxysterol-binding protein-related protein 9 (OSBPL9).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Oxysterol-binding protein-related protein 9 (OSBPL9).	[6]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Oxysterol-binding protein-related protein 9 (OSBPL9).	[7]

References

• [1] Association of oxysterol binding protein-related protein 9 polymorphism with cerebral infarction in Hunan Han population.Ir J Med Sci. 2014 Sep;183(3):439-48. doi: 10.1007/s11845-013-1035-6. Epub 2013 Nov 5.
• [2] OSBPL10, a novel candidate gene for high triglyceride trait in dyslipidemic Finnish subjects, regulates cellular lipid metabolism.J Mol Med (Berl). 2009 Aug;87(8):825-35. doi: 10.1007/s00109-009-0490-z. Epub 2009 Jun 25.
• [3] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [8] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.