Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYFD791)

DOT Name Translation machinery-associated protein 7 (TMA7)
Synonyms Coiled-coil domain-containing protein 72
Gene Name TMA7
UniProt ID
TMA7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF09072
Sequence
MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKK
SGKK
Tissue Specificity Expressed in dermal papilla cells with aggregative behavior.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Translation machinery-associated protein 7 (TMA7). [1]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Translation machinery-associated protein 7 (TMA7). [2]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Translation machinery-associated protein 7 (TMA7). [3]
Selenium DM25CGV Approved Selenium decreases the expression of Translation machinery-associated protein 7 (TMA7). [4]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Translation machinery-associated protein 7 (TMA7). [5]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Translation machinery-associated protein 7 (TMA7). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
2 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
5 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
6 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.