Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYV9U74)

• DOT Name: Histone deacetylase complex subunit SAP25 (SAP25)
• Synonyms: 25 kDa Sin3-associated polypeptide; Sin3 corepressor complex subunit SAP25
• Gene Name: SAP25
• UniProt ID: SAP25_HUMAN
• Pfam ID: PF15476
• Sequence:
  MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPAT
  GHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMS
  ARVLPRPSPSRGPSTAWLSGPELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSP
  SSSQGADLSLPQTPDTHCP
• Function: Involved in the transcriptional repression mediated by the mSIN3A but not the N-CoR corepressor complex.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Histone deacetylase complex subunit SAP25 (SAP25).	[1]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Histone deacetylase complex subunit SAP25 (SAP25).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Histone deacetylase complex subunit SAP25 (SAP25).	[2]

References

• [1] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [2] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [3] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.