Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTZ63UYL)
DOT Name | Olfactory receptor 10J5 (OR10J5) | ||||
---|---|---|---|---|---|
Synonyms | Olfactory receptor OR1-28 | ||||
Gene Name | OR10J5 | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMY
FFLSMLASSETVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGY DRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDI YPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATC VSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDAL CRVVGRNIS |
||||
Function |
Olfactory receptor. Activated by the synthetic floral odorant, lyral, and by alpha-cedrene, a sesquiterpene constituent of cedarwood oil. Its activation increases intracellular Ca(2+). Acts as a key regulator of myogenesis through its actions on cell migration and adhesion by activating the Ca(2+)-dependent AKT signal transduction pathway. Acts also as a regulator of angiogenesis. Moreover, plays a role in the regulation of lipid accumulation in hepatocytes via the cAMP-PKA pathway. May be involved in sperm chemotaxis and motility.
|
||||
Tissue Specificity | Expressed in both the aorta, the coronary artery and umbilical vein endothelial cells (HUVECs) (at protein level). | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||
References