Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZD0E3B)

DOT Name	Fatty acid-binding protein 12 (FABP12)
Gene Name	FABP12
Related Disease	Familial multiple trichoepithelioma ( ) Marie Unna hereditary hypotrichosis ( )
UniProt ID	FBP12_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00061
Sequence	MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKN NEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTV NSVICTRTYEKVSSNSVSNS
Function	May play a role in lipid transport.
Tissue Specificity	Expressed in a number of retinoblastoma cell lines.
Reactome Pathway	Triglyceride catabolism (R-HSA-163560 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Familial multiple trichoepithelioma	DISKZAUY	Strong	Genetic Variation	[1]
Marie Unna hereditary hypotrichosis	DISYE5SW	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Fatty acid-binding protein 12 (FABP12).	[2]
------------------------------------------------------------------------------------

References

1	Marie Unna hereditary hypotrichosis accompanied by multiple familial trichoepithelioma in a Chinese family.J Dermatol. 2019 May;46(5):413-417. doi: 10.1111/1346-8138.14811. Epub 2019 Feb 27.
2	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.