Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTZLRSDN)
| DOT Name | Sperm acrosome-associated protein 5 (SPACA5) | ||||
|---|---|---|---|---|---|
| Synonyms | EC 3.2.1.17; Lysozyme-like protein 5; Sperm-specific lysozyme-like protein X; SLLP-X | ||||
| Gene Name | SPACA5 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence |
MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVS SQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP |
||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||
References
