Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZV9IH0)

DOT Name Paired-like homeodomain transcription factor LEUTX (LEUTX)
Synonyms Leucine-twenty homeobox; Paired-like homeobox transcription factor LEUTX; PRD-LIKE homeobox transcription factor LEUTX
Gene Name LEUTX
Related Disease
Acute myelogenous leukaemia ( )
UniProt ID
LEUTX_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MFEGPRRYRRPRTRFLSKQLTALRELLEKTMHPSLATMGKLASKLQLDLSVVKIWFKNQR
AKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSG
IKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSL
NQYLFPVCLEYDQLQSSV
Function
[Isoform 1]: Paired-like homeobox transcription factor involved in embryogenesis. May act as a regulator of embryo genome activation. Binds to a 36 bp DNA elements containing a 5'-TAATCC-3' sequence motif, referred to as EEA motif (EGA-enriched Alu-motif), present in the promoters of target genes activated in early embryos ; [Isoform 2]: Inactive transcriptional activity.
Reactome Pathway
Zygotic genome activation (ZGA) (R-HSA-9819196 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Paired-like homeodomain transcription factor LEUTX (LEUTX). [2]
------------------------------------------------------------------------------------

References

1 The leucine twenty homeobox (LEUTX) gene, which lacks a histone acetyltransferase domain, is fused to KAT6A in therapy-related acute myeloid leukemia with t(8;19)(p11;q13).Genes Chromosomes Cancer. 2014 Apr;53(4):299-308. doi: 10.1002/gcc.22140. Epub 2014 Jan 21.
2 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.