Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZXGYKC)

• DOT Name: Galectin-9C (LGALS9C)
• Synonyms: Gal-9C; Galectin-9-like protein B
• Gene Name: LGALS9C
• Related Disease: Neoplasm
• UniProt ID: LEG9C_HUMAN
• Pfam ID: PF00337
• Sequence:
  MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAF
  HFNPRFEDGGYVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
  QYFHRVPFHRVDTISVNGSVQLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQK
  PPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSK
  SIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
  FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT
• Function: Binds galactosides.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Galectin-9C (LGALS9C).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Galectin-9C (LGALS9C).	[3]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Galectin-9C (LGALS9C).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galectin-9C (LGALS9C).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Galectin-9C (LGALS9C).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Galectin-9C (LGALS9C).	[5]

References

• [1] Molecular characteristics of a pancreatic adenocarcinoma associated with Shwachman-Diamond syndrome.Pediatr Blood Cancer. 2013 May;60(5):754-60. doi: 10.1002/pbc.24453. Epub 2013 Jan 9.
• [2] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [3] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.