Details of the Drug-Related molecule(s) Interaction Atlas
General Information of Drug (ID: DMVZB8U)
| Drug Name | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms | CHEMBL500283; WVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 | |||||||||||||||||||
| Indication |
|
|||||||||||||||||||
| Cross-matching ID | ||||||||||||||||||||
Molecule-Related Drug Atlas
|
Molecule-Related Drug Atlas
Molecule Type:
DTT Drug Status:
Clinical Trial Drug(s) Investigative Drug(s) |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Drug(s) Targeting Calcitonin gene-related peptide 1 (CALCA)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
| Molecular Interaction Atlas | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||

