Details of the Drug
General Information of Drug (ID: DM0WD1V)
Drug Name |
Human calcitonin
|
|||||
---|---|---|---|---|---|---|
Synonyms | Calcitonin (human synthetic); Calcitonin (human); Calcitonin human; Calcitonin, human; Calcitonin, human synthetic | |||||
Affected Organisms |
Humans and other mammals
|
|||||
ATC Code | ||||||
Sequence |
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
|
|||||
Structure |
![]() |
|||||
3D MOL is unavailable | 2D MOL | |||||
ADMET Property |
|
|||||
Cross-matching ID | ||||||
Molecular Interaction Atlas of This Drug
![]() Drug-Metabolizing Enzyme (DME) |
|
||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||
References