Details of the Drug
General Information of Drug (ID: DM0WD1V)
| Drug Name |
Human calcitonin
|
|||||
|---|---|---|---|---|---|---|
| Synonyms | Calcitonin (human synthetic); Calcitonin (human); Calcitonin human; Calcitonin, human; Calcitonin, human synthetic | |||||
| Affected Organisms |
Humans and other mammals
|
|||||
| ATC Code | ||||||
| Sequence |
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
|
|||||
| Structure |
![]() |
|||||
| 3D MOL is unavailable | 2D MOL | |||||
| ADMET Property |
|
|||||
| Cross-matching ID | ||||||
Molecular Interaction Atlas of This Drug
![]() Drug-Metabolizing Enzyme (DME) |
|
||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||
References


