Details of the Drug
General Information of Drug (ID: DM1O3BY)
| Drug Name |
Mecasermin
|
||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms | Increlex (TN) | ||||||||||||||||||||||||||
| Indication |
|
||||||||||||||||||||||||||
| Therapeutic Class |
Immunomodulatory Agents
|
||||||||||||||||||||||||||
| Affected Organisms |
Humans and other mammals
|
||||||||||||||||||||||||||
| ATC Code | |||||||||||||||||||||||||||
| Sequence |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA |
||||||||||||||||||||||||||
| ADMET Property |
|
||||||||||||||||||||||||||
| Cross-matching ID | |||||||||||||||||||||||||||
| Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
| The Studied Disease | Growth failure | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ICD Disease Classification | LD2F.1Y | |||||||||||||||||||||||
|
||||||||||||||||||||||||
| Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
|
Coadministration of a Drug Treating the Disease Different from Mecasermin (Comorbidity)
|
|||||||||||||||||||||||||||||||||||||||||||||||
References

