Details of the Drug
General Information of Drug (ID: DM1O3BY)
Drug Name |
Mecasermin
|
||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms | Increlex (TN) | ||||||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||||||
Therapeutic Class |
Immunomodulatory Agents
|
||||||||||||||||||||||||||
Affected Organisms |
Humans and other mammals
|
||||||||||||||||||||||||||
ATC Code | |||||||||||||||||||||||||||
Sequence |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA |
||||||||||||||||||||||||||
ADMET Property |
|
||||||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||||||
Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
The Studied Disease | Growth failure | |||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ICD Disease Classification | LD2F.1Y | |||||||||||||||||||||||
|
||||||||||||||||||||||||
Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
Coadministration of a Drug Treating the Disease Different from Mecasermin (Comorbidity)
|
References