Details of the Drug
General Information of Drug (ID: DM1O3BY)
| Drug Name | 
                     Mecasermin 
                 | 
            ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms | Increlex (TN) | ||||||||||||||||||||||||||
| Indication | 
                                                            
  | 
            ||||||||||||||||||||||||||
| Therapeutic Class | 
                     Immunomodulatory Agents 
                 | 
            ||||||||||||||||||||||||||
| Affected Organisms | 
                     Humans and other mammals 
                 | 
            ||||||||||||||||||||||||||
| ATC Code | |||||||||||||||||||||||||||
| Sequence | 
                                         
                        GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY 
                    
                CAPLKPAKSA  | 
            ||||||||||||||||||||||||||
| ADMET Property | 
                                                
  | 
                ||||||||||||||||||||||||||
| Cross-matching ID | |||||||||||||||||||||||||||
| Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT)  | 
                
                    
  | 
            ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
| The Studied Disease | Growth failure | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ICD Disease Classification | LD2F.1Y | |||||||||||||||||||||||
                    
  | 
            ||||||||||||||||||||||||
| Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
| 
                                                             Coadministration of a Drug Treating the Disease Different from Mecasermin (Comorbidity) 
                                                                
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||
References

