Details of the Drug
General Information of Drug (ID: DM25HP1)
| Drug Name |
Sermorelin
|
||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms |
Sermorelina; Sermoreline; Sermorelinum; Sermorelina [Spanish]; Sermoreline [French]; Sermorelinum [Latin]; Geref (TN); Sermorelin (INN); Sermorelin [INN:BAN]; GROWTH HORMONE RELEASING FACTOR, Fragment 1-29 Amide; Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
|
||||||||||||||||||||||
| Indication |
|
||||||||||||||||||||||
| Therapeutic Class |
Hormone Replacement Agents
|
||||||||||||||||||||||
| Affected Organisms |
Humans and other mammals
|
||||||||||||||||||||||
| ATC Code |
|
||||||||||||||||||||||
| Drug Type |
Small molecular drug
|
||||||||||||||||||||||
| Sequence |
YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
|
||||||||||||||||||||||
| Structure |
![]() |
||||||||||||||||||||||
| 3D MOL is unavailable | 2D MOL | ||||||||||||||||||||||
| #Ro5 Violations (Lipinski): 5 | Molecular Weight (mw) | 3357.9 | |||||||||||||||||||||
| Logarithm of the Partition Coefficient (xlogp) | -12.1 | ||||||||||||||||||||||
| Rotatable Bond Count (rotbonds) | 118 | ||||||||||||||||||||||
| Hydrogen Bond Donor Count (hbonddonor) | 52 | ||||||||||||||||||||||
| Hydrogen Bond Acceptor Count (hbondacc) | 49 | ||||||||||||||||||||||
| ADMET Property |
|
||||||||||||||||||||||
| Chemical Identifiers |
|
||||||||||||||||||||||
| Cross-matching ID | |||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
References


