Details of the Drug
General Information of Drug (ID: DM3FXPS)
Drug Name |
Liraglutide
|
||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms |
Liraglutida; Liraglutidum; Victoza; NN 2211; NN2211; Liraglutida [INN-Spanish]; Liraglutide [USAN:INN]; Liraglutidum [INN-Latin]; NN-2211; Victoza (TN); N26-(Hexadecanoyl-gamma-glutamyle)-(34-arginine)GLP-1-(7-37)-peptide; N26-(Hexadecanoyl-gamma-glutamyle)-(34-arginine)glucagon-like-peptide-1-(7-37)-peptide
|
||||||||||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||||||||||
Drug Type |
Small molecular drug
|
||||||||||||||||||||||||||||||
Sequence |
HAEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
|
||||||||||||||||||||||||||||||
Structure |
![]() |
||||||||||||||||||||||||||||||
3D MOL | 2D MOL | ||||||||||||||||||||||||||||||
#Ro5 Violations (Lipinski): 5 | Molecular Weight (mw) | 3751 | |||||||||||||||||||||||||||||
Logarithm of the Partition Coefficient (xlogp) | -3.4 | ||||||||||||||||||||||||||||||
Rotatable Bond Count (rotbonds) | 132 | ||||||||||||||||||||||||||||||
Hydrogen Bond Donor Count (hbonddonor) | 54 | ||||||||||||||||||||||||||||||
Hydrogen Bond Acceptor Count (hbondacc) | 55 | ||||||||||||||||||||||||||||||
ADMET Property |
|
||||||||||||||||||||||||||||||
Chemical Identifiers |
|
||||||||||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||||||||||
Combinatorial Drugs (CBD) | Click to Jump to the Detailed CBD Information of This Drug | ||||||||||||||||||||||||||||||
Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Drug-Metabolizing Enzyme (DME) |
|
||||||||||||||||||||||||||||||||||||
![]() Drug Off-Target (DOT) |
|
||||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
The Studied Disease | Non-insulin dependent diabetes | |||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ICD Disease Classification | 5A11 | |||||||||||||||||||||||||||||||||||
|
||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||||||||||||||
References