Details of the Drug
General Information of Drug (ID: DMKJY3U)
| Drug Name | 
                     parathyroid hormone 
                 | 
            ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Synonyms | NPH-002; NPH-004; oral parathyroid hormone (osteoporosis), Nobex | ||||||||||||||||||||||
| Indication | 
                                                            
  | 
            ||||||||||||||||||||||
| Affected Organisms | 
                     Humans and other mammals 
                 | 
            ||||||||||||||||||||||
| ATC Code | |||||||||||||||||||||||
| Sequence | 
                                         
                        SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLV 
                    
                ESHEKSLGEADKADVNVLTKAKSQ  | 
            ||||||||||||||||||||||
| ADMET Property | 
                                                
  | 
                ||||||||||||||||||||||
| Cross-matching ID | |||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT)  | 
                
                    
  | 
            ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
| The Studied Disease | Discovery agent | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ICD Disease Classification | N.A. | |||||||||||||||||||||||
                    
  | 
            ||||||||||||||||||||||||
| Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||

