Details of the Drug

General Information of Drug (ID: DMTZNQ9)

Drug Name
Interferon alfa-n3
Synonyms Alferon LDO; Interferon alfa-n3 (oral); Interferon alfa-n3 (oral), Hemispherx; Interferon alfa-n3 (oral), InterferonSciences
Indication
Disease Entry ICD 11 Status REF
Human immunodeficiency virus infection 1C62 Approved [1]
Affected Organisms
Humans and other mammals
Sequence
>Alpha-2A chain
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
>Alpha-2B chain
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
>Alpha-2C chain
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRRDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Cross-matching ID
UNII
47BPR3V3MP
DrugBank ID
DB00018
TTD ID
D07CMM

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Interferon alpha (IFNA) TT95SOA NOUNIPROTAC Modulator [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Interferon alfa-n3 (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Aminophylline DML2NIB Moderate Decreased metabolism of Interferon alfa-n3 caused by Aminophylline mediated inhibition of CYP450 enzyme. Asthma [CA23] [3]
Oxtriphylline DMLHSE3 Moderate Decreased metabolism of Interferon alfa-n3 caused by Oxtriphylline mediated inhibition of CYP450 enzyme. Cough [MD12] [3]
PMID28870136-Compound-48 DMPIM9L Moderate Decreased metabolism of Interferon alfa-n3 caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme. Discovery agent [N.A.] [3]
Polyethylene glycol DM4I1JP Moderate Increased risk of lowers seizure threshold by the combination of Interferon alfa-n3 and Polyethylene glycol. Irritable bowel syndrome [DD91] [4]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Interferon alfa-n3 and Cladribine. Mature B-cell leukaemia [2A82] [5]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n3 and Alemtuzumab. Mature B-cell leukaemia [2A82] [6]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n3 and Ocrelizumab. Multiple sclerosis [8A40] [7]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n3 and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [8]
Bupropion DM5PCS7 Major Increased risk of lowers seizure threshold by the combination of Interferon alfa-n3 and Bupropion. Nicotine use disorder [6C4A] [9]
Tramadol DMRQD04 Major Increased risk of lowers seizure threshold by the combination of Interferon alfa-n3 and Tramadol. Pain [MG30-MG3Z] [10]
Ropinirole DMA6S1D Moderate Decreased metabolism of Interferon alfa-n3 caused by Ropinirole mediated inhibition of CYP450 enzyme. Parkinsonism [8A00] [11]
Lindane DMB8CNL Moderate Increased risk of lowers seizure threshold by the combination of Interferon alfa-n3 and Lindane. Pediculosis [1G00] [12]
Pimozide DMW83TP Moderate Decreased metabolism of Interferon alfa-n3 caused by Pimozide mediated inhibition of CYP450 enzyme. Schizophrenia [6A20] [13]
⏷ Show the Full List of 13 DDI Information of This Drug

References

1 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006022)
2 Clinical pipeline report, company report or official report of Hemispherx Biopharma.
3 Cerner Multum, Inc. "Australian Product Information.".
4 Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
5 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
6 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
7 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
8 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
9 Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA.
10 Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
11 Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
12 Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
13 Krahenbuhl S, Sauter B, Kupferschmidt H, Krause M, Wyss PA, Meier PJ "Case report: reversible QT prolongation with torsades de pointes in a patient with pimozide intoxication." Am J Med Sci 309 (1995): 315-6. [PMID: 7771501]