Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTA4YLK)

DTP Name Peptide/histidine transporter 2 (SLC15A3)
Gene Name SLC15A3
UniProt ID
Q8IY34 (S15A3_HUMAN)
VARIDT ID
DTD0098
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms OCTP; Osteoclast transporter; PHT2; PTR3; Peptide transporter 3; Solute carrier family 15 member 3; SLC15A3
DTP Family Proton-Dependent Oligopeptide Transporter (POT/PTR) Family ;
Sequence
MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYL
NSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPA
TAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLT
SFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGLA
FFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPG
ASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISVA
LRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT
SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGL
EFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDL
YFFLLAGIQAVTALLFVWIAGRYERASQGPASHSRFSRDRG
Function This transporter is proton oligopeptide cotransporter and transports free histidine and certain di- and tripeptides.
Endogenous Substrate(s) Dipeptides; Tripeptides
TCDB ID
2.A.17.3.9
Gene ID
51296
Reactome Pathway
Proton/oligopeptide cotransporters (R-HSA-427975 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.12E-22 -8.65E-01 -1.19E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.17E-03 -3.64E-01 -1.30E+00
Alopecia ED70 Skin from scalp 1.13E-08 3.20E-01 1.10E+00
Alzheimer's disease 8A20 Entorhinal cortex 4.05E-09 3.45E-01 9.64E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.26E-01 1.81E-02 5.73E-02
Aortic stenosis BB70 Calcified aortic valve 7.84E-01 2.36E-01 2.19E-01
Apnea 7A40 Hyperplastic tonsil 3.44E-04 8.00E-01 2.33E+00
Arthropathy FA00-FA5Z Peripheral blood 3.93E-01 4.77E-03 1.31E-02
Asthma CA23 Nasal and bronchial airway 1.98E-02 1.21E-01 1.35E-01
Atopic dermatitis EA80 Skin 6.39E-01 1.46E-02 4.36E-02
Autism 6A02 Whole blood 6.66E-01 4.36E-02 1.09E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.20E-01 -1.96E-01 -6.79E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.53E-01 6.04E-01 1.43E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.16E-14 4.49E-01 1.30E+00
Batten disease 5C56.1 Whole blood 7.16E-01 -1.36E-01 -2.49E-01
Behcet's disease 4A62 Peripheral blood 9.61E-01 1.03E-01 3.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.14E-01 -3.77E-02 -1.93E-01
Bladder cancer 2C94 Bladder tissue 6.25E-01 -8.53E-02 -2.27E-01
Breast cancer 2C60-2C6Z Breast tissue 1.47E-10 1.77E-01 2.93E-01
Cardioembolic stroke 8B11.20 Whole blood 5.09E-02 2.08E-01 6.20E-01
Cervical cancer 2C77 Cervical tissue 7.70E-09 5.82E-01 2.36E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.58E-01 8.40E-02 9.44E-02
Chronic hepatitis C 1E51.1 Whole blood 4.74E-01 -2.84E-01 -3.31E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.00E-01 -1.42E-01 -3.69E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.81E-02 2.96E-01 5.21E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.54E-01 7.96E-02 3.10E-01
Colon cancer 2B90 Colon tissue 8.58E-02 4.89E-02 9.35E-02
Coronary artery disease BA80-BA8Z Peripheral blood 6.80E-01 2.33E-02 1.05E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.40E-01 -9.96E-02 -2.47E-01
Endometriosis GA10 Endometrium tissue 2.92E-01 2.42E-01 4.33E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.35E-02 -1.84E-01 -4.69E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.19E-15 8.92E-01 1.82E+00
Gastric cancer 2B72 Gastric tissue 3.31E-01 5.68E-01 8.42E-01
Glioblastopma 2A00.00 Nervous tissue 1.27E-46 5.35E-01 9.42E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.36E-01 5.35E-01 2.97E-01
Head and neck cancer 2D42 Head and neck tissue 3.80E-37 1.34E+00 2.56E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.48E-02 1.77E-01 6.38E-01
Huntington's disease 8A01.10 Whole blood 4.41E-01 1.02E-01 1.43E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.76E-03 6.34E-01 3.98E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.82E-01 3.58E-02 2.61E-01
Influenza 1.00E+30 Whole blood 1.56E-01 -1.68E-01 -3.47E-01
Interstitial cystitis GC00.3 Bladder tissue 2.71E-03 1.12E+00 2.84E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.45E-03 9.54E-01 2.97E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.85E-01 -2.30E-02 -3.47E-02
Ischemic stroke 8B11 Peripheral blood 7.37E-01 -1.04E-01 -2.81E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.83E-03 -2.13E-01 -3.83E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.27E-01 5.67E-02 1.32E-01
Lateral sclerosis 8B60.4 Skin 5.37E-01 5.15E-04 3.34E-03
Liver cancer 2C12.0 Liver tissue 6.84E-02 -1.72E-01 -4.17E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.05E-05 1.87E+00 3.09E+00
Lung cancer 2C25 Lung tissue 1.13E-67 -8.63E-01 -1.83E+00
Lupus erythematosus 4A40 Whole blood 6.77E-03 1.22E-01 2.12E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.35E-01 1.20E-01 2.02E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.70E-01 -2.40E-02 -1.26E-01
Melanoma 2C30 Skin 2.70E-06 8.32E-01 9.35E-01
Multiple myeloma 2A83.1 Bone marrow 6.42E-01 3.40E-01 4.71E-01
Multiple myeloma 2A83.1 Peripheral blood 4.33E-01 1.00E-01 6.02E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.46E-01 -3.84E-01 -6.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.46E-02 3.97E-01 4.76E-01
Myelofibrosis 2A20.2 Whole blood 7.64E-03 -5.83E-01 -1.93E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.46E-06 1.84E+00 1.45E+00
Myopathy 8C70.6 Muscle tissue 5.92E-07 1.02E+00 7.47E+00
Neonatal sepsis KA60 Whole blood 8.71E-12 6.76E-01 1.10E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.55E-06 -9.93E-01 -3.04E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.53E-01 2.84E-01 5.44E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.39E-01 3.75E-02 2.27E-01
Olive pollen allergy CA08.00 Peripheral blood 1.76E-01 6.03E-01 1.01E+00
Oral cancer 2B6E Oral tissue 1.32E-10 1.04E+00 2.01E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.55E-02 5.58E-01 7.18E-01
Osteoporosis FB83.1 Bone marrow 6.91E-01 2.34E-01 3.28E-01
Ovarian cancer 2C73 Ovarian tissue 5.95E-01 -9.07E-02 -3.83E-01
Pancreatic cancer 2C10 Pancreas 1.39E-04 7.76E-01 1.58E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.53E-01 2.77E-01 7.97E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.99E-03 3.50E-01 7.37E-01
Pituitary cancer 2D12 Pituitary tissue 4.70E-01 7.16E-02 1.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.18E-01 -1.49E-01 -6.75E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.59E-01 -3.96E-03 -4.00E-02
Polycythemia vera 2A20.4 Whole blood 5.35E-01 7.68E-02 2.50E-01
Pompe disease 5C51.3 Biceps muscle 1.44E-02 8.30E-01 1.05E+00
Preterm birth KA21.4Z Myometrium 6.08E-01 8.51E-02 8.38E-01
Prostate cancer 2C82 Prostate 5.37E-04 -2.51E-01 -4.09E-01
Psoriasis EA90 Skin 2.00E-03 -2.63E-01 -5.03E-01
Rectal cancer 2B92 Rectal colon tissue 8.12E-02 -1.83E-01 -1.20E+00
Renal cancer 2C90-2C91 Kidney 3.91E-08 9.76E-01 3.36E+00
Retinoblastoma 2D02.2 Uvea 8.61E-01 -3.03E-02 -7.54E-02
Rheumatoid arthritis FA20 Synovial tissue 3.51E-04 1.47E+00 2.25E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.07E-02 4.18E-02 1.80E-01
Schizophrenia 6A20 Prefrontal cortex 7.15E-02 5.24E-02 4.32E-02
Schizophrenia 6A20 Superior temporal cortex 4.35E-01 8.60E-02 4.26E-01
Scleroderma 4A42.Z Whole blood 6.24E-04 4.66E-01 1.77E+00
Seizure 8A60-8A6Z Whole blood 2.64E-01 -1.27E-01 -2.65E-01
Sensitive skin EK0Z Skin 1.91E-01 1.66E-01 1.00E+00
Sepsis with septic shock 1G41 Whole blood 2.14E-17 4.79E-01 9.11E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.36E-02 -5.48E-01 -2.94E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.09E-01 -1.59E-01 -7.95E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.50E-01 1.44E-01 3.59E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.23E-01 2.21E-01 5.31E-01
Skin cancer 2C30-2C3Z Skin 1.65E-04 2.51E-01 4.75E-01
Thrombocythemia 3B63 Whole blood 1.97E-01 -1.26E-01 -4.22E-01
Thrombocytopenia 3B64 Whole blood 2.78E-01 3.25E-01 2.49E-01
Thyroid cancer 2D10 Thyroid 2.00E-05 4.64E-01 6.52E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.26E-09 1.01E+00 3.19E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.19E-02 4.94E-01 2.21E+00
Type 2 diabetes 5A11 Liver tissue 5.09E-01 -5.43E-02 -9.76E-02
Ureter cancer 2C92 Urothelium 1.05E-01 -1.58E-01 -7.21E-01
Uterine cancer 2C78 Endometrium tissue 1.47E-04 3.15E-01 4.53E-01
Vitiligo ED63.0 Skin 6.00E-01 1.41E-01 3.73E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 15 member 3 (SLC15A3) DTT Info
DTP DTT Type Literature-reported
2 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
[14C]histidine DMVUF71 Discovery agent N.A. Investigative [1]
[3H]histidine DMJ5BDQ N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 986).