Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTBVQIO)

DTP Name Riboflavin transporter 2 (SLC52A3)
Gene Name SLC52A3
UniProt ID
Q9NQ40 (S52A3_HUMAN)
VARIDT ID
DTD0395
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms BVVLS; BVVLS1; C20orf54; RFT2; RFVT3; SLC52A3; Solute carrier family 52, riboflavin transporter, member 3; bA371L19.1; hRFT2
DTP Family Eukaryotic Riboflavin Transporter (E-RFT) Family ;
Tissue Specificity Predominantly expressed in testis. Highlyexpressed in small intestine and prostate.
Sequence
MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
LHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDC
TSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPV
PTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFV
LQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
AFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSL
LFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVV
LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA
Function This transporter is for riboflavin. Riboflavin transport is Na(+)-independent at low pH but significantly reduced by Na(+) depletion under neutral pH conditions.
TCDB ID
2.A.125.1.2
Gene ID
113278
KEGG Pathway
Vitamin digestion and absorption (hsa04977 )
Reactome Pathway
Vitamin B2 (riboflavin) metabolism (R-HSA-196843 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Riboflavin DM8YMWE Acne vulgaris ED80 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.02E-05 7.03E-02 3.13E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.53E-01 -7.86E-02 -2.73E-01
Alopecia ED70 Skin from scalp 9.82E-04 -1.82E-01 -6.14E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.26E-04 1.86E-01 6.61E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.05E-01 3.17E-02 2.54E-01
Aortic stenosis BB70 Calcified aortic valve 9.56E-01 2.90E-02 4.61E-02
Apnea 7A40 Hyperplastic tonsil 1.49E-01 -5.68E-02 -2.45E-01
Arthropathy FA00-FA5Z Peripheral blood 1.97E-01 3.36E-02 2.73E-01
Asthma CA23 Nasal and bronchial airway 1.62E-02 1.43E-01 3.08E-01
Atopic dermatitis EA80 Skin 3.65E-02 6.62E-02 7.41E-01
Autism 6A02 Whole blood 8.12E-01 7.48E-02 3.08E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.97E-02 -7.20E-02 -7.53E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.02E-01 -7.56E-02 -6.47E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.93E-15 3.52E-01 1.42E+00
Batten disease 5C56.1 Whole blood 1.14E-01 1.41E-01 1.08E+00
Behcet's disease 4A62 Peripheral blood 6.26E-01 9.22E-04 5.27E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.24E-01 6.45E-02 3.48E-01
Bladder cancer 2C94 Bladder tissue 8.91E-02 -3.46E-01 -1.20E+00
Breast cancer 2C60-2C6Z Breast tissue 2.56E-51 3.35E-01 1.21E+00
Cardioembolic stroke 8B11.20 Whole blood 1.38E-02 1.56E-01 9.63E-01
Cervical cancer 2C77 Cervical tissue 5.29E-02 -6.87E-02 -3.82E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.62E-01 1.93E-02 6.97E-02
Chronic hepatitis C 1E51.1 Whole blood 1.69E-02 1.13E-01 1.25E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 1.46E-01 1.37E-01 6.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.05E-02 8.78E-02 3.58E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.58E-02 1.68E-01 1.77E+00
Colon cancer 2B90 Colon tissue 5.43E-26 -3.75E-01 -1.09E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.35E-01 -5.37E-02 -2.78E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.74E-01 -3.39E-02 -2.70E-01
Endometriosis GA10 Endometrium tissue 1.03E-01 -8.18E-02 -1.61E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.35E-01 2.73E-02 1.99E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.79E-05 -2.63E-01 -1.06E+00
Gastric cancer 2B72 Gastric tissue 3.15E-01 4.41E-01 8.92E-01
Glioblastopma 2A00.00 Nervous tissue 8.81E-31 -1.88E-01 -5.07E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.97E-02 -1.23E-01 -6.37E-01
Head and neck cancer 2D42 Head and neck tissue 5.93E-03 1.67E-01 6.18E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.21E-01 -2.23E-02 -9.39E-02
Huntington's disease 8A01.10 Whole blood 3.93E-01 6.81E-02 4.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.89E-01 2.68E-02 1.62E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.69E-01 2.31E-02 2.37E-01
Influenza 1.00E+30 Whole blood 2.30E-03 3.13E-01 2.90E+00
Interstitial cystitis GC00.3 Bladder tissue 2.04E-02 -3.70E-01 -1.60E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.74E-01 1.40E-01 5.08E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.90E-03 -1.55E-01 -3.56E-01
Ischemic stroke 8B11 Peripheral blood 3.78E-01 -1.04E-02 -9.05E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.27E-03 5.99E-02 3.10E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.11E-01 9.70E-02 4.46E-01
Lateral sclerosis 8B60.4 Skin 5.87E-01 -1.47E-02 -5.35E-01
Liver cancer 2C12.0 Liver tissue 5.51E-01 -4.32E-02 -2.46E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.19E-01 7.96E-02 4.43E-01
Lung cancer 2C25 Lung tissue 1.06E-23 2.56E-01 1.13E+00
Lupus erythematosus 4A40 Whole blood 3.33E-02 -1.42E-01 -2.80E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.83E-02 6.07E-02 3.95E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.01E-01 2.97E-02 2.05E-01
Melanoma 2C30 Skin 1.31E-01 -2.15E-01 -5.55E-01
Multiple myeloma 2A83.1 Bone marrow 1.99E-01 5.06E-02 2.19E-01
Multiple myeloma 2A83.1 Peripheral blood 6.55E-01 -5.56E-02 -2.97E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.79E-02 1.83E-01 9.16E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.47E-07 1.76E-01 1.12E+00
Myelofibrosis 2A20.2 Whole blood 9.61E-02 7.63E-02 4.60E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.88E-01 2.68E-01 6.09E-01
Myopathy 8C70.6 Muscle tissue 8.01E-03 -1.96E-01 -9.75E-01
Neonatal sepsis KA60 Whole blood 4.91E-01 1.00E-01 3.64E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.50E-04 -6.34E-01 -2.13E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.01E-01 6.52E-02 4.65E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.73E-01 2.49E-02 2.13E-01
Olive pollen allergy CA08.00 Peripheral blood 4.08E-01 1.04E-01 5.35E-01
Oral cancer 2B6E Oral tissue 6.84E-01 2.06E-02 6.81E-02
Osteoarthritis FA00-FA0Z Synovial tissue 4.40E-01 -1.38E-01 -4.10E-01
Osteoporosis FB83.1 Bone marrow 1.43E-03 3.62E-01 4.81E+00
Ovarian cancer 2C73 Ovarian tissue 3.17E-02 4.39E-01 1.14E+00
Pancreatic cancer 2C10 Pancreas 3.78E-01 3.48E-02 7.12E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 3.35E-01 1.74E-01 4.57E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.67E-01 -4.16E-02 -2.54E-01
Pituitary cancer 2D12 Pituitary tissue 3.65E-02 2.19E-01 7.24E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.54E-02 1.26E-01 5.03E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.48E-01 -3.89E-02 -4.56E-01
Polycythemia vera 2A20.4 Whole blood 3.43E-01 6.41E-03 3.74E-02
Pompe disease 5C51.3 Biceps muscle 1.87E-01 -7.15E-02 -5.92E-01
Preterm birth KA21.4Z Myometrium 1.26E-01 -6.70E-02 -4.25E-01
Prostate cancer 2C82 Prostate 2.19E-04 -1.37E+00 -1.42E+00
Psoriasis EA90 Skin 2.71E-04 -6.02E-02 -1.86E-01
Rectal cancer 2B92 Rectal colon tissue 1.13E-01 -1.37E-01 -4.29E-01
Renal cancer 2C90-2C91 Kidney 2.07E-06 -9.72E-01 -3.34E+00
Retinoblastoma 2D02.2 Uvea 6.60E-01 6.17E-02 3.70E-01
Rheumatoid arthritis FA20 Synovial tissue 2.48E-01 -1.44E-01 -5.40E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.18E-01 6.13E-02 2.84E-01
Schizophrenia 6A20 Prefrontal cortex 5.26E-01 4.73E-02 1.39E-01
Schizophrenia 6A20 Superior temporal cortex 8.62E-01 -5.60E-03 -2.50E-02
Scleroderma 4A42.Z Whole blood 1.11E-02 1.82E-01 1.26E+00
Seizure 8A60-8A6Z Whole blood 2.27E-01 -2.13E-01 -8.37E-01
Sensitive skin EK0Z Skin 5.01E-01 8.67E-03 5.28E-02
Sepsis with septic shock 1G41 Whole blood 3.87E-01 2.13E-02 9.19E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.04E-01 1.86E-01 9.11E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.59E-01 9.44E-02 2.94E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.08E-01 8.09E-02 2.98E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.76E-01 1.26E-01 8.03E-01
Skin cancer 2C30-2C3Z Skin 1.64E-15 -3.48E-01 -7.13E-01
Thrombocythemia 3B63 Whole blood 8.03E-01 3.72E-02 2.24E-01
Thrombocytopenia 3B64 Whole blood 9.94E-01 5.29E-02 2.62E-01
Thyroid cancer 2D10 Thyroid 1.02E-10 1.70E-01 7.30E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.49E-03 -2.71E-01 -1.21E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.79E-01 1.65E-01 9.77E-01
Type 2 diabetes 5A11 Liver tissue 3.43E-02 -1.26E-01 -8.99E-01
Ureter cancer 2C92 Urothelium 4.48E-01 -2.27E-02 -1.47E-01
Uterine cancer 2C78 Endometrium tissue 6.97E-02 2.43E-03 5.58E-03
Vitiligo ED63.0 Skin 8.35E-01 -5.33E-02 -2.21E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 An intronic variation in SLC52A1 causes exon skipping and transient riboflavin-responsive multiple acyl-CoA dehydrogenation deficiency. Mol Genet Metab. 2017 Dec;122(4):182-188.