Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTDQSAM)

DTP Name Zinc transporter SLC39A7 (SLC39A7)
Gene Name SLC39A7
UniProt ID
Q92504 (S39A7_HUMAN)
VARIDT ID
DTD0348
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms D6S115E; D6S2244E; H2-KE4; HKE4; Histidine-rich membrane protein Ke4; KE4; RING5; Really interesting new gene 5 protein; SLC39A7; Solute carrier family 39 member 7; ZIP7; Zinc transporter SLC39A7
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Tissue Specificity Widely expressed.
Sequence
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH
AHGHGHTHESIWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGES
GAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGL
LGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV
KGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP
VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEV
PHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE
Function
This transporter is zinc transporter which transports Zn(2+) from the endoplasmic reticulum/Golgi apparatus to the cytosol. Transport is stimulated by growth factors, such as EGF, and Ca(2+), as well as by exogenous Zn(2+).
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.4.3
Gene ID
7922
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Reactome Pathway
Zinc influx into cells by the SLC39 gene family (R-HSA-442380 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.81E-07 9.08E-02 2.44E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.00E-01 2.71E-01 3.58E-01
Alopecia ED70 Skin from scalp 7.10E-04 -2.49E-01 -6.57E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.21E-02 -5.72E-02 -2.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.53E-01 9.48E-02 2.91E-01
Aortic stenosis BB70 Calcified aortic valve 6.72E-01 6.82E-01 6.32E-01
Apnea 7A40 Hyperplastic tonsil 8.80E-02 8.21E-01 3.70E+00
Arthropathy FA00-FA5Z Peripheral blood 9.81E-01 -7.45E-03 -3.98E-02
Asthma CA23 Nasal and bronchial airway 4.06E-02 9.63E-02 1.39E-01
Atopic dermatitis EA80 Skin 5.89E-01 -9.39E-02 -3.58E-01
Autism 6A02 Whole blood 2.65E-01 1.03E-02 4.93E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.75E-02 -2.72E-01 -1.03E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.14E-01 -1.44E-01 -5.42E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.71E-18 9.05E-01 1.76E+00
Batten disease 5C56.1 Whole blood 4.93E-01 1.56E-02 1.55E-01
Behcet's disease 4A62 Peripheral blood 7.80E-01 5.69E-02 2.44E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.71E-01 1.58E-02 7.58E-02
Bladder cancer 2C94 Bladder tissue 1.05E-02 -3.27E-01 -1.49E+00
Breast cancer 2C60-2C6Z Breast tissue 8.58E-54 7.70E-01 1.00E+00
Cardioembolic stroke 8B11.20 Whole blood 2.50E-06 2.03E-01 1.41E+00
Cervical cancer 2C77 Cervical tissue 9.41E-01 2.24E-02 5.53E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.19E-01 8.23E-02 3.44E-01
Chronic hepatitis C 1E51.1 Whole blood 7.17E-01 5.61E-02 2.16E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.70E-02 -3.16E-01 -5.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.48E-02 1.64E-01 3.83E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.96E-02 3.47E-01 1.39E+00
Colon cancer 2B90 Colon tissue 1.34E-02 -2.15E-01 -3.31E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.92E-01 1.34E-01 5.34E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.25E-01 -1.78E-01 -8.57E-01
Endometriosis GA10 Endometrium tissue 6.55E-01 -2.22E-01 -1.73E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.19E-02 -1.56E-01 -6.03E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.31E-02 2.11E-01 7.46E-01
Gastric cancer 2B72 Gastric tissue 1.39E-01 1.11E+00 1.13E+00
Glioblastopma 2A00.00 Nervous tissue 1.17E-72 7.35E-01 1.20E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.38E-05 1.47E+00 2.61E+00
Head and neck cancer 2D42 Head and neck tissue 8.43E-16 5.16E-01 1.22E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.99E-01 4.99E-03 1.38E-02
Huntington's disease 8A01.10 Whole blood 1.91E-01 -8.45E-02 -4.47E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.07E-01 -2.31E-01 -4.96E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.50E-01 4.40E-02 2.45E-01
Influenza 1.00E+30 Whole blood 8.87E-02 -1.46E+00 -2.37E+00
Interstitial cystitis GC00.3 Bladder tissue 6.78E-03 4.30E-01 1.86E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.68E-09 6.47E-01 2.99E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.56E-02 -4.42E-01 -8.04E-01
Ischemic stroke 8B11 Peripheral blood 4.42E-01 -1.76E-02 -7.83E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.28E-05 -3.45E-01 -7.67E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.33E-01 1.83E-01 3.52E-01
Lateral sclerosis 8B60.4 Skin 6.04E-01 -3.67E-01 -1.07E+00
Liver cancer 2C12.0 Liver tissue 1.93E-04 6.29E-01 8.95E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.31E-01 2.71E-02 4.81E-02
Lung cancer 2C25 Lung tissue 3.73E-76 1.02E+00 2.21E+00
Lupus erythematosus 4A40 Whole blood 2.15E-01 -1.24E-01 -2.89E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.84E-01 -1.83E-02 -3.83E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.77E-01 -1.27E-02 -6.80E-02
Melanoma 2C30 Skin 3.64E-01 3.95E-01 4.41E-01
Multiple myeloma 2A83.1 Bone marrow 1.32E-05 1.52E+00 3.76E+00
Multiple myeloma 2A83.1 Peripheral blood 9.90E-01 -9.03E-02 -3.30E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.27E-01 4.72E-03 8.88E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.60E-02 -2.42E-01 -3.56E-01
Myelofibrosis 2A20.2 Whole blood 9.75E-02 -1.23E-01 -6.65E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.87E-01 7.33E-02 1.19E-01
Myopathy 8C70.6 Muscle tissue 1.14E-01 3.46E-02 1.32E-01
Neonatal sepsis KA60 Whole blood 3.17E-02 -8.64E-02 -1.89E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.90E-06 2.62E+00 3.33E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.27E-01 -1.30E-01 -1.98E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.77E-04 -9.52E-01 -5.84E+00
Olive pollen allergy CA08.00 Peripheral blood 1.85E-01 -5.40E-02 -2.13E-01
Oral cancer 2B6E Oral tissue 6.88E-03 6.49E-01 9.42E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.14E-02 1.35E+00 1.35E+00
Osteoporosis FB83.1 Bone marrow 1.50E-02 -6.06E-01 -2.39E+00
Ovarian cancer 2C73 Ovarian tissue 1.10E-03 1.10E+00 1.67E+00
Pancreatic cancer 2C10 Pancreas 7.88E-02 2.47E-01 3.59E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.40E-01 -2.10E-01 -5.22E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.00E-01 2.19E-03 8.89E-03
Pituitary cancer 2D12 Pituitary tissue 1.90E-01 -5.72E-01 -6.38E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.48E-01 -7.13E-01 -9.73E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.39E-01 1.84E-01 5.76E-01
Polycythemia vera 2A20.4 Whole blood 5.34E-04 -1.53E-01 -8.32E-01
Pompe disease 5C51.3 Biceps muscle 8.70E-04 4.67E-01 1.65E+00
Preterm birth KA21.4Z Myometrium 2.00E-01 -1.87E-01 -5.12E-01
Prostate cancer 2C82 Prostate 1.62E-07 1.75E+00 1.71E+00
Psoriasis EA90 Skin 3.94E-04 1.45E-01 2.34E-01
Rectal cancer 2B92 Rectal colon tissue 2.62E-01 -1.93E-01 -6.66E-01
Renal cancer 2C90-2C91 Kidney 3.39E-04 7.17E-01 1.49E+00
Retinoblastoma 2D02.2 Uvea 3.54E-05 1.13E+00 4.98E+00
Rheumatoid arthritis FA20 Synovial tissue 6.67E-05 1.37E+00 3.58E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.12E-01 4.66E-02 1.59E-01
Schizophrenia 6A20 Prefrontal cortex 6.00E-01 -4.04E-02 -1.14E-01
Schizophrenia 6A20 Superior temporal cortex 1.61E-01 -1.37E-01 -6.32E-01
Scleroderma 4A42.Z Whole blood 3.48E-04 2.02E-01 1.36E+00
Seizure 8A60-8A6Z Whole blood 9.17E-02 -9.56E-02 -3.81E-01
Sensitive skin EK0Z Skin 5.73E-01 6.43E-02 1.56E-01
Sepsis with septic shock 1G41 Whole blood 2.51E-01 -1.17E-01 -2.37E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.52E-02 -3.97E-01 -2.22E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.14E-01 -1.73E-02 -1.42E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.19E-02 -2.18E-01 -1.98E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.63E-04 -8.89E-01 -3.28E+00
Skin cancer 2C30-2C3Z Skin 1.16E-29 8.59E-01 1.12E+00
Thrombocythemia 3B63 Whole blood 6.23E-03 -1.08E-01 -5.97E-01
Thrombocytopenia 3B64 Whole blood 7.50E-01 8.52E-02 1.00E-01
Thyroid cancer 2D10 Thyroid 1.29E-05 -2.90E-01 -6.04E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.57E-01 -7.01E-02 -1.98E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.45E-01 1.09E-01 1.26E+00
Type 2 diabetes 5A11 Liver tissue 6.57E-01 1.27E-01 2.56E-01
Ureter cancer 2C92 Urothelium 1.48E-01 8.17E-02 7.25E-01
Uterine cancer 2C78 Endometrium tissue 8.83E-07 -1.03E+00 -9.29E-01
Vitiligo ED63.0 Skin 1.51E-01 1.04E-01 6.09E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 A ZIP6-ZIP10 heteromer controls NCAM1 phosphorylation and integration into focal adhesion complexes during epithelial-to-mesenchymal transition. Sci Rep. 2017 Jan 18;7:40313.