Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTFSLX5)

DTP Name Sulfate transporter (SLC26A2)
Gene Name SLC26A2
UniProt ID
P50443 (S26A2_HUMAN)
VARIDT ID
DTD0230
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms D5S1708; DTD; DTDST; Diastrophic dysplasia protein; EDM4; MST153; MSTP157; SLC26A2; Solute carrier family 26 member 2
DTP Family Sulfate Permease (SULP) Family ;
Tissue Specificity Ubiquitously expressed.
Sequence
MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQE
KSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDREL
QKAGYDNAHSAPSLGMVSNGSTLLNHTSDRICDKSCYAIMVGSTVTFIAGVYQVAMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRTNGVGSLITTWIHVFRNIHKT
NLCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSI
AGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQK
SVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSIF
CVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIKPGIKIFRFVAPLYYINKECFKSALY
KQTVNPILIKVAWKKAAKRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAMAFAE
VSKNQKGVCVPNGLSLSSD
Function This sulfate transporter may play a role in endochondral bone formation.
Endogenous Substrate(s) Cl-; Hydroxide
TCDB ID
2.A.53.2.1
Gene ID
1836
KEGG Pathway
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Reactome Pathway
Defective SLC26A2 causes chondrodysplasias (R-HSA-3560792 )
Multifunctional anion exchangers (R-HSA-427601 )
Transport and synthesis of PAPS (R-HSA-174362 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
SULFATE DMW0ZBF Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.93E-02 5.80E-02 1.11E-01
Adrenocortical carcinoma 2D11.Z Kidney 8.10E-01 5.00E-02 4.53E-02
Alopecia ED70 Skin from scalp 8.51E-01 1.73E-01 2.66E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.59E-03 3.12E-01 4.49E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.95E-01 -3.53E-01 -5.18E-01
Aortic stenosis BB70 Calcified aortic valve 8.83E-01 -4.97E-02 -6.76E-02
Apnea 7A40 Hyperplastic tonsil 8.18E-01 5.14E-01 5.76E-01
Arthropathy FA00-FA5Z Peripheral blood 3.41E-01 -1.53E-01 -4.21E-01
Asthma CA23 Nasal and bronchial airway 3.40E-03 2.05E-01 1.65E-01
Atopic dermatitis EA80 Skin 3.87E-01 1.40E-01 2.68E-01
Autism 6A02 Whole blood 2.60E-01 9.73E-02 2.73E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.11E-01 4.02E-01 2.76E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.08E-01 2.46E-01 3.14E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.26E-01 6.46E-02 1.17E-01
Batten disease 5C56.1 Whole blood 9.06E-01 2.06E-01 7.24E-01
Behcet's disease 4A62 Peripheral blood 7.23E-01 -1.75E-02 -7.85E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.53E-01 9.86E-02 5.48E-01
Bladder cancer 2C94 Bladder tissue 1.19E-05 -1.68E+00 -3.85E+00
Breast cancer 2C60-2C6Z Breast tissue 1.49E-01 -2.01E-01 -2.74E-01
Cardioembolic stroke 8B11.20 Whole blood 3.64E-01 -5.88E-03 -9.96E-03
Cervical cancer 2C77 Cervical tissue 1.23E-01 3.54E-01 3.11E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.47E-01 -8.51E-02 -9.27E-02
Chronic hepatitis C 1E51.1 Whole blood 8.96E-01 -7.58E-02 -3.68E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.91E-02 -2.04E-01 -3.46E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.29E-02 -1.56E-01 -1.62E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.33E-01 -1.17E+00 -8.35E-01
Colon cancer 2B90 Colon tissue 1.48E-245 -4.12E+00 -7.49E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.25E-01 3.44E-01 4.90E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.20E-01 -4.48E-02 -5.41E-02
Endometriosis GA10 Endometrium tissue 4.76E-01 -8.70E-01 -9.46E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.86E-01 -1.03E-01 -5.96E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.86E-09 7.76E-01 1.55E+00
Gastric cancer 2B72 Gastric tissue 7.02E-02 8.57E-01 1.90E+00
Glioblastopma 2A00.00 Nervous tissue 2.55E-80 1.46E+00 1.52E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.19E-01 4.03E-01 7.11E-01
Head and neck cancer 2D42 Head and neck tissue 8.60E-36 -1.63E+00 -2.18E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.61E-06 5.23E-01 1.42E+00
Huntington's disease 8A01.10 Whole blood 7.90E-01 -1.24E-02 -4.32E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.98E-02 -3.20E-01 -6.37E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.62E-01 -7.34E-02 -5.05E-01
Influenza 1.00E+30 Whole blood 3.76E-04 -1.24E+00 -4.53E+00
Interstitial cystitis GC00.3 Bladder tissue 2.96E-04 -8.78E-01 -2.82E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.35E-03 1.12E+00 3.87E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.98E-02 -1.12E-01 -2.98E-01
Ischemic stroke 8B11 Peripheral blood 1.13E-02 -5.04E-01 -1.46E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 1.04E-03 1.66E-01 3.53E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.25E-01 4.17E-03 2.20E-03
Lateral sclerosis 8B60.4 Skin 3.59E-01 -2.01E-01 -5.32E-01
Liver cancer 2C12.0 Liver tissue 2.56E-16 8.89E-01 1.76E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.53E-04 8.42E-01 2.45E+00
Lung cancer 2C25 Lung tissue 2.20E-56 -7.88E-01 -1.78E+00
Lupus erythematosus 4A40 Whole blood 7.83E-10 -8.07E-01 -1.09E+00
Major depressive disorder 6A70-6A7Z Whole blood 9.84E-01 -3.18E-03 -6.13E-03
Major depressive disorder 6A70-6A7Z Hippocampus 2.26E-01 6.20E-02 3.41E-01
Melanoma 2C30 Skin 1.08E-01 2.40E-01 2.02E-01
Multiple myeloma 2A83.1 Bone marrow 5.31E-01 -1.05E-01 -3.78E-01
Multiple myeloma 2A83.1 Peripheral blood 1.41E-01 -1.29E-01 -5.04E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.65E-01 -1.20E-01 -5.15E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.05E-01 -1.93E-01 -2.55E-01
Myelofibrosis 2A20.2 Whole blood 3.54E-03 -2.11E-01 -8.96E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.41E-01 -1.66E-01 -2.02E-01
Myopathy 8C70.6 Muscle tissue 3.43E-03 5.14E-01 1.93E+00
Neonatal sepsis KA60 Whole blood 5.43E-04 -2.17E-01 -5.13E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.97E-01 6.60E-01 4.81E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 7.13E-01 7.44E-02 1.63E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.37E-01 1.00E-02 3.02E-02
Olive pollen allergy CA08.00 Peripheral blood 2.27E-02 -6.36E-01 -2.16E+00
Oral cancer 2B6E Oral tissue 4.63E-01 -6.71E-02 -5.48E-02
Osteoarthritis FA00-FA0Z Synovial tissue 8.61E-01 8.57E-02 1.09E-01
Osteoporosis FB83.1 Bone marrow 8.91E-01 -1.04E-01 -3.60E-01
Ovarian cancer 2C73 Ovarian tissue 1.89E-02 2.88E-01 5.89E-01
Pancreatic cancer 2C10 Pancreas 8.82E-04 5.88E-01 1.51E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.07E-02 6.73E-01 1.31E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.46E-01 1.19E-01 4.49E-01
Pituitary cancer 2D12 Pituitary tissue 1.77E-01 1.12E-01 1.90E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.74E-01 -4.62E-02 -7.88E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.52E-02 5.75E-02 4.93E-01
Polycythemia vera 2A20.4 Whole blood 1.62E-10 -3.35E-01 -1.56E+00
Pompe disease 5C51.3 Biceps muscle 1.51E-01 4.62E-01 1.47E+00
Preterm birth KA21.4Z Myometrium 1.12E-01 -3.12E-01 -6.54E-01
Prostate cancer 2C82 Prostate 1.01E-03 -2.01E+00 -1.16E+00
Psoriasis EA90 Skin 3.54E-40 -1.52E+00 -2.37E+00
Rectal cancer 2B92 Rectal colon tissue 2.30E-14 -2.62E+00 -8.84E+00
Renal cancer 2C90-2C91 Kidney 4.05E-02 6.88E-01 7.98E-01
Retinoblastoma 2D02.2 Uvea 1.59E-03 -1.06E+00 -1.68E+00
Rheumatoid arthritis FA20 Synovial tissue 6.63E-01 -8.04E-02 -1.45E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.31E-01 -1.09E-01 -2.49E-01
Schizophrenia 6A20 Prefrontal cortex 2.89E-01 2.21E-01 2.34E-01
Schizophrenia 6A20 Superior temporal cortex 1.60E-01 1.81E-01 3.73E-01
Scleroderma 4A42.Z Whole blood 3.04E-03 -2.29E-01 -1.11E+00
Seizure 8A60-8A6Z Whole blood 9.82E-01 1.24E-01 3.09E-01
Sensitive skin EK0Z Skin 5.04E-01 -8.69E-03 -3.76E-02
Sepsis with septic shock 1G41 Whole blood 4.37E-05 -2.67E-01 -7.09E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.98E-01 -4.98E-02 -7.09E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.66E-04 -8.98E-01 -1.26E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.51E-01 -2.91E-01 -7.12E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.99E-01 5.94E-01 1.02E+00
Skin cancer 2C30-2C3Z Skin 1.31E-13 -1.06E+00 -1.11E+00
Thrombocythemia 3B63 Whole blood 2.71E-02 -1.86E-01 -8.34E-01
Thrombocytopenia 3B64 Whole blood 4.40E-01 -4.61E-01 -3.61E-01
Thyroid cancer 2D10 Thyroid 3.08E-11 3.01E-01 8.96E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.02E-04 5.96E-01 1.56E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.59E-01 -4.40E-01 -4.96E-01
Type 2 diabetes 5A11 Liver tissue 3.11E-02 1.79E-01 1.53E+00
Ureter cancer 2C92 Urothelium 6.19E-01 -1.24E-01 -4.14E-01
Uterine cancer 2C78 Endometrium tissue 2.05E-03 -6.43E-01 -4.11E-01
Vitiligo ED63.0 Skin 7.89E-01 7.55E-02 1.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Regulated transport of sulfate and oxalate by SLC26A2/DTDST. Am J Physiol Cell Physiol. 2010 Jun;298(6):C1363-75.