Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTPTFKU)

DTP Name Adenine nucleotide translocator 1 (SLC25A4)
Gene Name SLC25A4
UniProt ID
P12235 (ADT1_HUMAN)
VARIDT ID
DTD0202
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
AAC1; ADP,ATP carrier protein 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; ANT; ANT 1; ANT1; ADP/ATP translocase 1; MTDPS12; MTDPS12A; PEO2; PEO3; PEOA2; SLC25A4; Solute carrier family 25 member 4; T1
DTP Family Mitochondrial Carrier (MC) Family ;
Sequence
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Function This transporter mediates mitochondrial ADP/ATP transport. Catalyzes the exchange of cytoplasmic ADP and mitochondrial adenosine triphosphate through mitochondrial inner membrane.
Endogenous Substrate(s) ATP; ADP
TCDB ID
2.A.29.1.2
Gene ID
291
KEGG Pathway
Calcium signaling pathway (hsa04020 )
cGMP-PKG signaling pathway (hsa04022 )
Necroptosis (hsa04217 )
Cellular senescence (hsa04218 )
Neutrophil extracellular trap formation (hsa04613 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Influenza A (hsa05164 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization (R-HSA-180897 )
Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane (R-HSA-83936 )
Mitochondrial protein import (R-HSA-1268020 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.77E-01 5.28E-03 2.70E-02
Adrenocortical carcinoma 2D11.Z Kidney 4.18E-02 -1.35E-01 -5.66E-01
Alopecia ED70 Skin from scalp 2.11E-04 1.58E-01 6.15E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.76E-05 -5.02E-01 -9.02E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.24E-01 1.90E-01 1.19E+00
Aortic stenosis BB70 Calcified aortic valve 3.12E-01 -3.84E-01 -4.44E-01
Apnea 7A40 Hyperplastic tonsil 3.56E-01 1.63E-01 7.60E-01
Arthropathy FA00-FA5Z Peripheral blood 5.09E-01 -3.74E-02 -3.36E-01
Asthma CA23 Nasal and bronchial airway 3.78E-05 -8.68E-02 -9.25E-02
Atopic dermatitis EA80 Skin 2.10E-02 -1.63E-01 -8.77E-01
Autism 6A02 Whole blood 9.57E-01 2.72E-02 2.23E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.26E-02 -1.95E-01 -3.22E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.23E-01 -1.45E-02 -1.06E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.15E-01 2.66E-02 2.16E-01
Batten disease 5C56.1 Whole blood 3.66E-01 -1.13E-01 -9.78E-01
Behcet's disease 4A62 Peripheral blood 7.19E-01 8.60E-03 7.80E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.87E-01 1.04E-02 2.80E-02
Bladder cancer 2C94 Bladder tissue 3.83E-03 -6.47E-01 -1.52E+00
Breast cancer 2C60-2C6Z Breast tissue 1.18E-20 -3.44E-01 -8.50E-01
Cardioembolic stroke 8B11.20 Whole blood 6.69E-01 -6.58E-02 -2.80E-01
Cervical cancer 2C77 Cervical tissue 4.36E-01 -6.33E-02 -2.68E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.30E-01 3.43E-02 2.11E-01
Chronic hepatitis C 1E51.1 Whole blood 9.15E-01 -4.43E-02 -1.51E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.07E-01 -1.35E-02 -7.24E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.32E-01 2.17E-02 1.31E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.66E-02 -2.88E-01 -9.99E-01
Colon cancer 2B90 Colon tissue 5.28E-15 -1.50E-01 -8.02E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.61E-02 2.84E-01 5.09E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.13E-01 -1.15E-01 -7.79E-01
Endometriosis GA10 Endometrium tissue 9.38E-02 -9.32E-02 -3.16E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.24E-01 -1.04E-01 -1.49E+00
Familial hypercholesterolemia 5C80.00 Whole blood 3.11E-05 -3.53E-01 -1.65E+00
Gastric cancer 2B72 Gastric tissue 5.59E-03 -1.10E+00 -6.82E+00
Glioblastopma 2A00.00 Nervous tissue 3.93E-98 -1.17E+00 -1.67E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.09E-02 2.62E-01 5.82E-01
Head and neck cancer 2D42 Head and neck tissue 8.95E-21 -7.64E-01 -1.42E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.48E-01 -5.89E-01 -9.43E-01
Huntington's disease 8A01.10 Whole blood 4.45E-01 4.55E-02 2.77E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.90E-02 -2.72E-01 -1.52E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.41E-02 -1.62E-01 -1.55E+00
Influenza 1.00E+30 Whole blood 3.58E-03 3.48E-01 6.57E+00
Interstitial cystitis GC00.3 Bladder tissue 7.42E-02 -2.55E-01 -6.78E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.62E-04 -1.28E+00 -3.63E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.34E-01 -5.26E-02 -1.89E-01
Ischemic stroke 8B11 Peripheral blood 5.90E-01 6.79E-02 4.76E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.79E-06 -2.08E-01 -9.26E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.00E-01 6.20E-02 6.60E-02
Lateral sclerosis 8B60.4 Skin 7.64E-01 4.58E-02 1.99E-01
Liver cancer 2C12.0 Liver tissue 1.72E-11 -2.78E-01 -1.31E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.21E-05 -7.34E-01 -1.14E+01
Lung cancer 2C25 Lung tissue 9.16E-43 -3.44E-01 -1.72E+00
Lupus erythematosus 4A40 Whole blood 3.69E-05 -1.00E-01 -3.68E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.74E-01 -3.06E-02 -1.42E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.63E-01 3.53E-02 1.11E-01
Melanoma 2C30 Skin 9.13E-01 -6.83E-02 -1.02E-01
Multiple myeloma 2A83.1 Bone marrow 3.68E-06 5.62E-01 3.66E+00
Multiple myeloma 2A83.1 Peripheral blood 1.48E-01 -9.50E-02 -9.15E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.08E-01 -2.26E-02 -8.03E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.63E-01 4.92E-02 2.37E-01
Myelofibrosis 2A20.2 Whole blood 3.21E-01 -6.85E-03 -7.16E-02
Myocardial infarction BA41-BA50 Peripheral blood 4.83E-01 -3.73E-02 -1.20E-01
Myopathy 8C70.6 Muscle tissue 2.03E-03 -2.48E-01 -1.05E+00
Neonatal sepsis KA60 Whole blood 4.68E-13 -2.45E-01 -1.49E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.21E-01 -8.27E-02 -2.63E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.47E-01 -6.21E-02 -3.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.65E-01 -1.03E-01 -8.23E-01
Olive pollen allergy CA08.00 Peripheral blood 4.54E-02 1.71E-01 1.59E+00
Oral cancer 2B6E Oral tissue 3.38E-04 -6.92E-01 -6.22E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.46E-01 -1.88E-01 -1.31E-01
Osteoporosis FB83.1 Bone marrow 9.94E-01 2.47E-01 1.04E+00
Ovarian cancer 2C73 Ovarian tissue 1.66E-01 -1.36E-02 -3.46E-02
Pancreatic cancer 2C10 Pancreas 1.85E-01 -7.07E-02 -2.61E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.89E-01 -2.60E-01 -5.42E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.49E-01 -7.31E-03 -4.65E-02
Pituitary cancer 2D12 Pituitary tissue 6.22E-02 2.08E-01 5.74E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.60E-02 1.31E-01 4.72E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.32E-01 -3.87E-02 -2.88E-01
Polycythemia vera 2A20.4 Whole blood 2.42E-01 -4.85E-02 -4.80E-01
Pompe disease 5C51.3 Biceps muscle 3.82E-04 -1.27E+00 -3.41E+00
Preterm birth KA21.4Z Myometrium 4.80E-02 4.83E-01 1.66E+00
Prostate cancer 2C82 Prostate 2.83E-02 4.92E-01 8.70E-01
Psoriasis EA90 Skin 1.71E-08 -2.78E-01 -9.45E-01
Rectal cancer 2B92 Rectal colon tissue 3.36E-03 -4.81E-01 -2.26E+00
Renal cancer 2C90-2C91 Kidney 8.39E-04 -6.03E-01 -1.91E+00
Retinoblastoma 2D02.2 Uvea 7.86E-10 -1.54E+00 -8.11E+00
Rheumatoid arthritis FA20 Synovial tissue 6.41E-02 -5.61E-01 -4.03E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.42E-01 -4.38E-02 -4.67E-01
Schizophrenia 6A20 Prefrontal cortex 3.03E-02 -4.99E-01 -3.59E-01
Schizophrenia 6A20 Superior temporal cortex 9.05E-01 -2.68E-01 -6.19E-01
Scleroderma 4A42.Z Whole blood 8.96E-03 -1.13E-01 -9.91E-01
Seizure 8A60-8A6Z Whole blood 2.46E-01 8.83E-02 5.30E-01
Sensitive skin EK0Z Skin 1.36E-01 -3.18E-01 -2.34E+00
Sepsis with septic shock 1G41 Whole blood 2.06E-20 -2.41E-01 -1.46E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.85E-01 -1.80E-02 -1.27E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.01E-01 -3.16E-02 -2.05E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.78E-01 9.29E-02 4.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.82E-03 -3.62E-01 -5.50E+00
Skin cancer 2C30-2C3Z Skin 1.77E-04 1.25E-01 3.53E-01
Thrombocythemia 3B63 Whole blood 6.03E-01 2.46E-02 2.51E-01
Thrombocytopenia 3B64 Whole blood 9.51E-01 8.39E-02 2.25E-01
Thyroid cancer 2D10 Thyroid 1.07E-15 -3.21E-01 -1.11E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.69E-03 -4.14E-01 -9.45E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.66E-03 -9.55E-01 -1.22E+01
Type 2 diabetes 5A11 Liver tissue 8.98E-01 3.55E-02 1.55E-01
Ureter cancer 2C92 Urothelium 9.81E-01 -3.78E-02 -2.06E-01
Uterine cancer 2C78 Endometrium tissue 2.08E-11 3.29E-01 9.75E-01
Vitiligo ED63.0 Skin 6.56E-01 5.78E-02 2.18E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Adenine nucleotide translocator 1 (SLC25A4) DTT Info
DTP DTT Type Successful
1 Approved Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Clodronate DM9Y6X7 Hypercalcaemia 5B91.0 Approved [1]
------------------------------------------------------------------------------------
4 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
bongkrek acid DMWALXQ Discovery agent N.A. Investigative [2]
Carboxyatractyloside DMEORTQ Discovery agent N.A. Investigative [3]
Cardiolipin DMCSMX4 Discovery agent N.A. Investigative [4]
Di-Stearoyl-3-Sn-Phosphatidylcholine DM0GQJ2 Discovery agent N.A. Investigative [3]
------------------------------------------------------------------------------------

References

1 Further insight into mechanism of action of clodronate: inhibition of mitochondrial ADP/ATP translocase by a nonhydrolyzable, adenine-containing metabolite. Mol Pharmacol. 2002 May;61(5):1255-62.
2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1062).
3 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
4 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.