Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTTWL58)

DTP Name Sodium-coupled neutral amino acid transporter 2 (SLC38A2)
Gene Name SLC38A2
UniProt ID
Q96QD8 (S38A2_HUMAN)
VARIDT ID
DTD0329
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
ATA2; Amino acid transporter A2; KIAA1382; PRO1068; Protein 40-9-1; SAT2; SLC38A2; SNAT2; Solute carrier family 38 member 2; System A amino acid transporter 2; System A transporter 1; System N amino acid transporter 2
DTP Family Amino Acid/Auxin Permease (AAAP) Family ;
Tissue Specificity Ubiquitously expressed. Widely expressed inthe central nervous system with higher concentrations in caudalregions. Expressed by glutamatergic and GABAergic neurons togetherwith astrocytes and other non-neuronal cells in the cerebralcortex (at protein level).
Sequence
MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGYKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQAL
TNIEDKTGLWYLNGNYLVLLVSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKK
FQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILI
FSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLH
TYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLL
SGVLVMTGSMALIVLDWVHNAPGGGH
Function
This sodium-dependent amino acid transporter mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta.
Endogenous Substrate(s) Amino acids; Sodium ion
TCDB ID
2.A.18.6.5
Gene ID
54407
KEGG Pathway
Glutamatergic synapse (hsa04724 )
GABAergic synapse (hsa04727 )
Protein digestion and absorption (hsa04974 )
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )
Glutamate Neurotransmitter Release Cycle (R-HSA-210500 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Alanine DMZDN4W Dietary shortage 5B5K Approved [1]
L-glutamine DM69G8X Short bowel syndrome KB89.1 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.14E-13 3.51E-01 6.67E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.51E-01 -5.40E-02 -1.01E-01
Alopecia ED70 Skin from scalp 1.65E-01 1.50E-02 6.50E-02
Alzheimer's disease 8A20 Entorhinal cortex 4.45E-08 4.35E-01 9.85E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.26E-01 -3.10E-01 -7.10E-01
Aortic stenosis BB70 Calcified aortic valve 7.85E-01 -1.04E-01 -1.25E-01
Apnea 7A40 Hyperplastic tonsil 6.37E-01 -1.92E-02 -1.79E-02
Arthropathy FA00-FA5Z Peripheral blood 5.92E-01 3.45E-02 1.01E-01
Asthma CA23 Nasal and bronchial airway 1.41E-04 2.51E-01 4.43E-01
Atopic dermatitis EA80 Skin 5.78E-02 -2.43E-01 -5.26E-01
Autism 6A02 Whole blood 2.74E-02 1.25E-01 2.65E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.98E-01 9.03E-03 1.39E-02
Autosomal dominant monocytopenia 4B04 Whole blood 1.13E-02 4.24E-01 9.62E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.15E-05 -1.84E-01 -6.73E-01
Batten disease 5C56.1 Whole blood 6.10E-01 -2.95E-01 -8.90E-01
Behcet's disease 4A62 Peripheral blood 9.88E-01 1.33E-02 4.80E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.98E-01 1.29E-01 4.05E-01
Bladder cancer 2C94 Bladder tissue 1.91E-04 -3.84E-01 -2.44E+00
Breast cancer 2C60-2C6Z Breast tissue 1.21E-01 -3.33E-02 -6.20E-02
Cardioembolic stroke 8B11.20 Whole blood 1.11E-02 2.45E-01 1.70E+00
Cervical cancer 2C77 Cervical tissue 5.90E-01 1.09E-01 3.05E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.85E-02 7.45E-02 6.15E-01
Chronic hepatitis C 1E51.1 Whole blood 8.41E-01 5.60E-02 1.31E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.97E-03 2.21E-01 9.24E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.69E-06 -3.03E-01 -4.74E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.75E-03 -8.27E-01 -1.65E+00
Colon cancer 2B90 Colon tissue 5.38E-30 4.60E-01 1.25E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.71E-01 1.09E+00 1.11E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.63E-01 1.77E-01 3.16E-01
Endometriosis GA10 Endometrium tissue 3.16E-02 8.73E-01 1.07E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.38E-01 1.61E-01 8.40E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.50E-03 4.09E-01 1.28E+00
Gastric cancer 2B72 Gastric tissue 2.54E-01 -5.64E-01 -1.16E+00
Glioblastopma 2A00.00 Nervous tissue 7.37E-01 5.71E-02 1.03E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.60E-02 -2.27E-01 -8.32E-01
Head and neck cancer 2D42 Head and neck tissue 1.19E-26 8.08E-01 1.52E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.91E-01 -1.19E-01 -1.73E-01
Huntington's disease 8A01.10 Whole blood 3.99E-01 3.97E-02 9.47E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.68E-03 -6.98E-01 -2.23E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.87E-02 -3.35E-01 -9.01E-01
Influenza 1.00E+30 Whole blood 8.61E-03 -1.54E+00 -4.84E+00
Interstitial cystitis GC00.3 Bladder tissue 6.64E-05 -4.75E-01 -3.96E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.32E-01 1.63E-02 2.35E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.75E-01 -1.82E-02 -1.20E-01
Ischemic stroke 8B11 Peripheral blood 2.17E-01 6.32E-02 1.85E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.90E-02 -3.12E-03 -9.00E-03
Lateral sclerosis 8B60.4 Cervical spinal cord 3.26E-03 -1.55E+00 -1.47E+00
Lateral sclerosis 8B60.4 Skin 4.49E-01 2.15E-02 1.01E-01
Liver cancer 2C12.0 Liver tissue 1.41E-03 -6.03E-01 -7.20E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.82E-03 -1.06E+00 -1.76E+00
Lung cancer 2C25 Lung tissue 3.78E-30 -4.19E-01 -1.03E+00
Lupus erythematosus 4A40 Whole blood 8.56E-05 3.38E-01 8.10E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.16E-01 -6.79E-02 -1.20E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.38E-01 -5.24E-02 -1.58E-01
Melanoma 2C30 Skin 3.28E-02 -2.60E-01 -3.60E-01
Multiple myeloma 2A83.1 Bone marrow 6.09E-04 7.31E-01 1.67E+00
Multiple myeloma 2A83.1 Peripheral blood 3.88E-01 1.42E-01 2.95E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.08E-01 -5.51E-02 -5.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.34E-04 -4.03E-01 -7.93E-01
Myelofibrosis 2A20.2 Whole blood 2.21E-01 -3.01E-01 -7.02E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.33E-01 5.48E-02 1.54E-01
Myopathy 8C70.6 Muscle tissue 5.70E-01 -1.04E-01 -2.71E-01
Neonatal sepsis KA60 Whole blood 1.52E-08 5.85E-01 7.51E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.16E-03 7.98E-01 1.85E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.89E-01 4.05E-01 6.53E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.43E-02 -4.58E-01 -1.88E+00
Olive pollen allergy CA08.00 Peripheral blood 2.09E-01 -3.04E-01 -8.79E-01
Oral cancer 2B6E Oral tissue 1.80E-05 6.58E-01 1.04E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.32E-01 7.14E-01 7.99E-01
Osteoporosis FB83.1 Bone marrow 5.34E-01 -1.16E-01 -3.53E-01
Ovarian cancer 2C73 Ovarian tissue 3.29E-01 4.07E-01 8.07E-01
Pancreatic cancer 2C10 Pancreas 1.03E-01 1.23E-01 1.48E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.67E-03 7.69E-01 1.37E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.38E-02 -1.69E-01 -1.09E+00
Pituitary cancer 2D12 Pituitary tissue 1.24E-01 -5.75E-01 -6.46E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.78E-03 -7.92E-01 -1.04E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.38E-01 -1.05E-02 -1.83E-02
Polycythemia vera 2A20.4 Whole blood 8.62E-03 -3.50E-01 -8.01E-01
Pompe disease 5C51.3 Biceps muscle 2.60E-03 -3.67E-01 -3.88E+00
Preterm birth KA21.4Z Myometrium 7.05E-01 2.66E-01 2.51E-01
Prostate cancer 2C82 Prostate 6.60E-04 -3.31E-01 -7.24E-01
Psoriasis EA90 Skin 4.07E-14 -3.15E-01 -1.04E+00
Rectal cancer 2B92 Rectal colon tissue 3.66E-04 5.06E-01 2.96E+00
Renal cancer 2C90-2C91 Kidney 2.94E-01 1.41E-01 2.42E-01
Retinoblastoma 2D02.2 Uvea 8.08E-01 2.69E-01 6.00E-01
Rheumatoid arthritis FA20 Synovial tissue 8.54E-03 4.20E-01 9.64E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.04E-01 1.16E-01 4.09E-01
Schizophrenia 6A20 Prefrontal cortex 8.53E-01 1.03E-01 2.59E-01
Schizophrenia 6A20 Superior temporal cortex 6.30E-01 -5.78E-02 -1.18E-01
Scleroderma 4A42.Z Whole blood 9.47E-03 -1.55E-01 -1.13E+00
Seizure 8A60-8A6Z Whole blood 4.85E-01 2.97E-01 6.93E-01
Sensitive skin EK0Z Skin 3.66E-01 -2.01E-02 -1.08E-01
Sepsis with septic shock 1G41 Whole blood 4.39E-10 4.23E-01 7.64E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.06E-01 -3.59E-01 -1.09E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.58E-01 -4.61E-01 -4.39E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.25E-01 -5.18E-02 -7.32E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.54E-01 3.16E-02 8.38E-02
Skin cancer 2C30-2C3Z Skin 1.52E-61 -7.48E-01 -1.76E+00
Thrombocythemia 3B63 Whole blood 7.06E-03 -4.47E-01 -1.05E+00
Thrombocytopenia 3B64 Whole blood 7.01E-01 -1.71E-01 -1.35E-01
Thyroid cancer 2D10 Thyroid 4.90E-03 1.03E-01 2.35E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.05E-01 -2.05E-01 -5.22E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.53E-02 -6.06E-01 -2.78E+00
Type 2 diabetes 5A11 Liver tissue 4.49E-01 -2.90E-01 -7.91E-01
Ureter cancer 2C92 Urothelium 3.10E-01 5.41E-02 7.77E-02
Uterine cancer 2C78 Endometrium tissue 3.10E-06 3.44E-01 4.49E-01
Vitiligo ED63.0 Skin 7.27E-01 3.48E-02 2.72E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 38 member 2 (SLC38A2) DTT Info
DTP DTT Type Literature-reported

References

1 Identification of SLC38A7 (SNAT7) protein as a glutamine transporter expressed in neurons. J Biol Chem. 2011 Jun 10;286(23):20500-11.