| DTP Name |
Voltage-dependent calcium channel gamma-3 (CACNG3)
|
| Gene Name |
CACNG3
|
| UniProt ID |
|
| VARIDT ID |
|
| 3D Structure |
|
| Synonyms |
CACNG3; Neuronal voltage-gated calcium channel gamma-3 subunit; TARP gamma-3; Transmembrane AMPAR regulatory protein gamma-3; Voltage-dependent calcium channel gamma-3 subunit |
| DTP Family |
Ca(+) Channel Auxiliary Subunit Gama1-Gama8 (CCAgama) Family
;
|
| Sequence |
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV
|
| Function |
This transporter regulates the trafficking to the somatodendritic compartment and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
|
| Endogenous Substrate(s) |
Ca2+
|
| TCDB ID |
|
| Gene ID |
|
| KEGG Pathway |
- MAPK signaling pathway (hsa04010 )
- Cardiac muscle contraction (hsa04260 )
- Adrenergic signaling in cardiomyocytes (hsa04261 )
- Oxytocin signaling pathway (hsa04921 )
- Hypertrophic cardiomyopathy (hsa05410 )
- Arrhythmogenic right ventricular cardiomyopathy (hsa05412 )
- Dilated cardiomyopathy (hsa05414 )
|
| Reactome Pathway |
- LGI-ADAM interactions (R-HSA-5682910 )
- Trafficking of AMPA receptors (R-HSA-399719 )
|
|
|
|
|
|
|