Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTVGOLN)

DTP Name Anion exchange transporter (SLC26A6)
Gene Name SLC26A6
UniProt ID
Q9BXS9 (S26A6_HUMAN)
VARIDT ID
DTD0234
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Pendrin-L1; Pendrin-like protein 1; SLC26A6; Solute carrier family 26 member 6
DTP Family Sulfate Permease (SULP) Family ;
Tissue Specificity Ubiquitous. Highest levels in kidney andpancreas. Lower expression in heart, skeletal muscle, liver andplacenta. Also found in lung and brain. Isoform 4 is ubiquitouslyexpressed. Isoform 6 is expressed in heart, brain, placenta, lung,liver, kidney, pancreas, spleen, thymus, prostate, testis andovary. Isoform 5 is expressed weakly in placenta, lung, liver andpancreas.
Sequence
MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWL
QCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAAR
VQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVT
FTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGV
KVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ
AASPKGASVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKA
LGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGH
FFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
Function
This transporter mediates also intestinal chloride absorption and oxalate secretion, thereby preventing hyperoxaluria and calcium oxalate urolithiasis. And it acts as a versatile DIDS-sensitive inorganic and organic anion transporter that mediates the uptake of monovalent anions like chloride, bicarbonate, formate and hydroxyl ion and divalent anions like sulfate and oxalate.
Endogenous Substrate(s) Cl-; Hydrogen sulfate; Hydroxide; Formate
TCDB ID
2.A.53.2.7
Gene ID
65010
KEGG Pathway
Mineral absorption (hsa04978 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Reactome Pathway
Multifunctional anion exchangers (R-HSA-427601 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
3 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
BICARBONATE DMT5E36 Discovery agent N.A. Investigative [1]
oxalate DM40SEU Discovery agent N.A. Investigative [2]
SULFATE DMW0ZBF Discovery agent N.A. Investigative [3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.42E-12 -1.59E+00 -1.42E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.19E-01 4.21E-01 5.91E-01
Alopecia ED70 Skin from scalp 1.06E-01 -1.64E-01 -3.88E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.89E-03 1.39E-01 5.46E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.65E-01 3.08E-01 4.79E-01
Aortic stenosis BB70 Calcified aortic valve 3.66E-01 3.85E-01 9.73E-01
Apnea 7A40 Hyperplastic tonsil 8.27E-01 -3.52E-01 -1.50E+00
Arthropathy FA00-FA5Z Peripheral blood 7.03E-01 -1.33E-02 -4.56E-02
Asthma CA23 Nasal and bronchial airway 1.11E-01 3.14E-01 2.54E-01
Atopic dermatitis EA80 Skin 8.52E-01 -1.58E-02 -1.16E-01
Autism 6A02 Whole blood 8.99E-01 -2.81E-01 -3.51E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.68E-02 9.72E-01 2.62E+00
Autosomal dominant monocytopenia 4B04 Whole blood 9.59E-01 2.02E-01 2.40E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.07E-01 -6.87E-02 -1.87E-01
Batten disease 5C56.1 Whole blood 4.84E-01 5.08E-02 1.56E-01
Behcet's disease 4A62 Peripheral blood 6.17E-01 -2.03E-01 -3.04E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.57E-01 2.33E-02 1.33E-01
Bladder cancer 2C94 Bladder tissue 4.02E-02 -4.69E-01 -1.50E+00
Breast cancer 2C60-2C6Z Breast tissue 1.80E-12 5.81E-01 8.21E-01
Cardioembolic stroke 8B11.20 Whole blood 1.09E-09 -6.53E-01 -2.03E+00
Cervical cancer 2C77 Cervical tissue 1.73E-03 -1.70E-01 -5.39E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.57E-02 -2.32E-01 -3.91E-01
Chronic hepatitis C 1E51.1 Whole blood 6.11E-02 -9.51E-02 -4.45E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.36E-03 3.86E-01 9.10E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.05E-01 -1.08E-01 -2.08E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.02E-01 -1.92E-01 -4.81E-01
Colon cancer 2B90 Colon tissue 6.34E-28 5.59E-01 1.20E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.90E-01 4.05E-01 5.04E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.97E-01 -4.92E-02 -6.01E-02
Endometriosis GA10 Endometrium tissue 4.72E-01 -3.58E-01 -4.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.98E-01 1.26E-01 3.68E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.57E-01 2.58E-01 6.17E-01
Gastric cancer 2B72 Gastric tissue 3.86E-02 -1.65E+00 -3.59E+00
Glioblastopma 2A00.00 Nervous tissue 4.39E-15 2.31E-01 5.00E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.49E-01 -3.76E-02 -1.12E-01
Head and neck cancer 2D42 Head and neck tissue 6.95E-07 2.59E-01 6.48E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.45E-01 1.03E-01 4.11E-01
Huntington's disease 8A01.10 Whole blood 8.83E-01 -8.13E-02 -1.94E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.43E-02 -1.00E-01 -3.80E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.34E-01 -2.77E-02 -1.49E-01
Influenza 1.00E+30 Whole blood 1.56E-01 1.35E-01 9.26E-01
Interstitial cystitis GC00.3 Bladder tissue 2.27E-02 4.18E-01 1.68E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.04E-01 -1.58E-01 -3.12E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.20E-01 -1.33E-01 -3.08E-01
Ischemic stroke 8B11 Peripheral blood 4.70E-01 -2.62E-01 -6.30E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.60E-01 8.04E-02 1.16E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.39E-01 -3.39E-01 -7.49E-01
Lateral sclerosis 8B60.4 Skin 9.41E-01 -4.05E-02 -1.52E-01
Liver cancer 2C12.0 Liver tissue 3.71E-01 -2.63E-01 -3.37E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.63E-01 9.20E-02 3.63E-01
Lung cancer 2C25 Lung tissue 4.91E-05 5.64E-01 7.08E-01
Lupus erythematosus 4A40 Whole blood 9.87E-09 -5.60E-01 -6.52E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.31E-01 -6.18E-02 -1.58E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.99E-01 -3.69E-02 -2.41E-01
Melanoma 2C30 Skin 4.21E-01 3.02E-01 3.92E-01
Multiple myeloma 2A83.1 Bone marrow 1.74E-03 2.44E-01 7.33E-01
Multiple myeloma 2A83.1 Peripheral blood 9.63E-01 1.78E-01 2.99E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.23E-01 9.83E-02 3.38E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.33E-04 -3.35E-01 -5.74E-01
Myelofibrosis 2A20.2 Whole blood 1.05E-01 -3.49E-01 -1.28E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.34E-01 1.28E-01 1.65E-01
Myopathy 8C70.6 Muscle tissue 2.98E-02 -1.28E-01 -4.43E-01
Neonatal sepsis KA60 Whole blood 2.39E-01 6.13E-02 9.22E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.74E-07 -1.02E+00 -3.44E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.30E-01 8.37E-02 3.56E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.11E-02 4.69E-01 1.30E+00
Olive pollen allergy CA08.00 Peripheral blood 1.60E-01 -7.21E-01 -9.85E-01
Oral cancer 2B6E Oral tissue 4.92E-01 2.31E-01 5.04E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.06E-01 3.13E-01 5.09E-01
Osteoporosis FB83.1 Bone marrow 4.49E-01 -2.26E-01 -3.77E-01
Ovarian cancer 2C73 Ovarian tissue 1.61E-02 -3.27E-01 -6.25E-01
Pancreatic cancer 2C10 Pancreas 6.29E-02 3.24E-01 5.22E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.23E-01 -6.86E-02 -2.21E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.06E-02 -1.75E-01 -4.29E-01
Pituitary cancer 2D12 Pituitary tissue 1.67E-06 -9.75E-01 -2.31E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.22E-03 -5.86E-01 -1.83E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.51E-01 -4.01E-02 -1.97E-01
Polycythemia vera 2A20.4 Whole blood 1.56E-06 -2.24E-01 -7.78E-01
Pompe disease 5C51.3 Biceps muscle 8.32E-01 -8.38E-02 -6.66E-01
Preterm birth KA21.4Z Myometrium 8.13E-01 -1.31E-01 -4.02E-01
Prostate cancer 2C82 Prostate 2.55E-05 -1.89E+00 -1.64E+00
Psoriasis EA90 Skin 1.31E-03 -2.63E-01 -3.26E-01
Rectal cancer 2B92 Rectal colon tissue 1.52E-18 5.97E-01 1.06E+01
Renal cancer 2C90-2C91 Kidney 1.11E-02 -6.73E-01 -1.42E+00
Retinoblastoma 2D02.2 Uvea 1.74E-07 1.51E+00 3.02E+00
Rheumatoid arthritis FA20 Synovial tissue 2.50E-01 -3.54E-01 -6.34E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.15E-01 -2.34E-02 -1.29E-01
Schizophrenia 6A20 Prefrontal cortex 7.98E-01 6.30E-03 1.76E-02
Schizophrenia 6A20 Superior temporal cortex 3.22E-01 1.39E-02 1.16E-01
Scleroderma 4A42.Z Whole blood 2.23E-02 -2.09E-01 -9.42E-01
Seizure 8A60-8A6Z Whole blood 1.12E-01 -2.97E-01 -7.52E-01
Sensitive skin EK0Z Skin 8.16E-01 5.32E-02 1.31E-01
Sepsis with septic shock 1G41 Whole blood 2.93E-05 5.65E-01 7.90E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.72E-01 -6.31E-01 -1.00E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.48E-02 -6.36E-01 -1.45E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.73E-02 -9.69E-02 -8.42E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.36E-01 -9.64E-02 -7.85E-01
Skin cancer 2C30-2C3Z Skin 7.30E-16 -4.33E-01 -5.72E-01
Thrombocythemia 3B63 Whole blood 7.16E-02 1.47E-03 5.05E-03
Thrombocytopenia 3B64 Whole blood 4.39E-01 -7.06E-01 -8.06E-01
Thyroid cancer 2D10 Thyroid 3.68E-01 1.80E-01 2.65E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.93E-02 9.01E-01 1.14E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.27E-02 3.27E-01 2.34E+00
Type 2 diabetes 5A11 Liver tissue 8.98E-01 7.48E-02 1.27E-01
Ureter cancer 2C92 Urothelium 3.45E-01 -3.86E-02 -5.09E-02
Uterine cancer 2C78 Endometrium tissue 8.65E-01 -9.75E-02 -1.17E-01
Vitiligo ED63.0 Skin 5.44E-01 -5.90E-02 -2.06E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Metabolon disruption: a mechanism that regulates bicarbonate transport. EMBO J. 2005 Jul 20;24(14):2499-511.
2 Oxalate (urine, plasma)
3 The Transporter Classification Database (TCDB): recent advances. Nucleic Acids Res. 2016 Jan 4;44(D1):D372-9. (ID: 2.A.53.2.7)