Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTVHQT2)

DTP Name Zinc transporter 5 (SLC30A5)
Gene Name SLC30A5
UniProt ID
Q8TAD4 (ZNT5_HUMAN)
VARIDT ID
DTD0274
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC30A5; Solute carrier family 30 member 5; ZNT5; ZNTL1; ZTL1; ZnT-5; ZnT-like transporter 1; hZTL1
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Tissue Specificity Ubiquitously expressed. Highly expressed inpancreas, liver and kidney. Expressed abundantly in insulin-containing beta cells, undetectable in other endocrine cell typesincluding glucagon-secreting alpha cells and most acinar cells.
Sequence
MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIV
QFIFILKLGTAFFMVLFQKPFSSGKTITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLR
TLLLFEHSDIVVISLLSVLFTSSGGGPAKTRGAAFFIIAVICLLLFDNDDLMAKMAEHPE
GHHDSALTHMLYTAIAFLGVADHKGGVLLLVLALCCKVGFHTASRKLSVDVGGAKRLQAL
SHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFATVIFFVMILDFYVDSICSVKMEVSK
CARYGSFPIFISALLFGNFWTHPITDQLRAMNKAAHQESTEHVLSGGVVVSAIFFILSAN
ILSSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQIF
YFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYG
YGRIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDTHMLTPVSVGGLIVNLIGICAF
SHAHSHAHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADT
LGSIGVIVSTVLIEQFGWFIADPLCSLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKEL
HIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSDVLEQRIVQQVTGILKDAGVN
NLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYCKDGTYIM
Function
This transporter is a zinc transporter. May be a transporter of zinc into beta cells in order to form insulin crystals. Partly regulates cellular zinc homeostasis. Required with ZNT7 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.4.3
Gene ID
64924
Reactome Pathway
Zinc efflux and compartmentalization by the SLC30 family (R-HSA-435368 )
Insulin processing (R-HSA-264876 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.70E-02 1.86E-01 5.54E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.04E-02 1.52E-01 3.40E-01
Alopecia ED70 Skin from scalp 4.58E-01 4.75E-02 2.18E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.29E-04 -2.04E-01 -7.33E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.29E-01 2.94E-02 7.05E-02
Aortic stenosis BB70 Calcified aortic valve 5.27E-01 2.70E-01 4.57E-01
Apnea 7A40 Hyperplastic tonsil 1.89E-01 -4.46E-01 -9.17E-01
Arthropathy FA00-FA5Z Peripheral blood 6.02E-01 2.72E-02 7.97E-02
Asthma CA23 Nasal and bronchial airway 1.79E-01 9.68E-02 1.28E-01
Atopic dermatitis EA80 Skin 1.75E-01 -2.35E-01 -9.34E-01
Autism 6A02 Whole blood 1.64E-01 -4.83E-02 -1.31E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.91E-01 2.59E-01 4.22E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.05E-01 -2.18E-01 -7.22E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.26E-01 1.10E-01 3.64E-01
Batten disease 5C56.1 Whole blood 1.52E-01 9.19E-02 7.79E-01
Behcet's disease 4A62 Peripheral blood 7.51E-01 -3.55E-02 -1.16E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.62E-01 -6.47E-02 -3.27E-01
Bladder cancer 2C94 Bladder tissue 3.83E-07 -7.41E-01 -4.28E+00
Breast cancer 2C60-2C6Z Breast tissue 6.51E-07 1.32E-01 2.71E-01
Cardioembolic stroke 8B11.20 Whole blood 3.22E-04 -1.26E-01 -7.93E-01
Cervical cancer 2C77 Cervical tissue 2.65E-04 1.04E-01 7.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.13E-01 3.51E-02 7.78E-02
Chronic hepatitis C 1E51.1 Whole blood 6.45E-01 -1.62E-01 -9.05E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.89E-01 -1.51E-01 -2.88E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.27E-03 -2.61E-01 -5.66E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.71E-01 -5.75E-02 -1.53E-01
Colon cancer 2B90 Colon tissue 4.77E-10 -2.83E-01 -6.81E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.47E-01 3.56E-01 5.84E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.73E-01 2.48E-01 5.16E-01
Endometriosis GA10 Endometrium tissue 6.75E-01 -8.46E-02 -1.63E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.42E-02 -2.13E-01 -1.16E+00
Familial hypercholesterolemia 5C80.00 Whole blood 5.16E-08 5.24E-01 1.15E+00
Gastric cancer 2B72 Gastric tissue 1.91E-01 3.92E-01 6.65E-01
Glioblastopma 2A00.00 Nervous tissue 3.99E-74 6.44E-01 1.20E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.32E-01 1.58E-01 3.69E-01
Head and neck cancer 2D42 Head and neck tissue 1.50E-05 -2.36E-01 -3.50E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.58E-01 -7.08E-02 -2.22E-01
Huntington's disease 8A01.10 Whole blood 4.88E-01 6.47E-02 1.74E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.37E-01 -1.04E-01 -4.71E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.11E-01 -1.63E-01 -6.73E-01
Influenza 1.00E+30 Whole blood 7.43E-03 -1.16E+00 -3.36E+00
Interstitial cystitis GC00.3 Bladder tissue 5.49E-01 -9.20E-02 -3.38E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.06E-02 2.38E-01 5.94E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.87E-01 3.64E-02 1.69E-01
Ischemic stroke 8B11 Peripheral blood 9.35E-01 1.33E-02 5.14E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 6.87E-01 2.72E-02 9.79E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 2.05E-01 -1.82E-01 -2.28E-01
Lateral sclerosis 8B60.4 Skin 1.20E-01 2.70E-01 1.11E+00
Liver cancer 2C12.0 Liver tissue 9.97E-01 4.66E-02 9.81E-02
Liver failure DB99.7-DB99.8 Liver tissue 9.69E-03 -3.27E-01 -2.32E+00
Lung cancer 2C25 Lung tissue 3.08E-02 9.62E-03 1.84E-02
Lupus erythematosus 4A40 Whole blood 7.06E-02 3.60E-01 3.96E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.02E-01 -1.55E-02 -3.28E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.40E-01 -8.35E-02 -4.83E-01
Melanoma 2C30 Skin 3.08E-01 -2.85E-01 -3.26E-01
Multiple myeloma 2A83.1 Bone marrow 1.32E-03 4.38E-01 1.78E+00
Multiple myeloma 2A83.1 Peripheral blood 3.53E-01 -1.40E-01 -6.12E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.92E-01 6.30E-02 2.00E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.18E-03 -1.17E-01 -4.77E-01
Myelofibrosis 2A20.2 Whole blood 1.41E-06 -5.13E-01 -2.05E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.63E-04 -1.20E+00 -1.26E+00
Myopathy 8C70.6 Muscle tissue 4.46E-01 4.03E-02 1.89E-01
Neonatal sepsis KA60 Whole blood 9.75E-02 1.63E-01 2.65E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.33E-06 1.64E+00 3.40E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.33E-01 1.53E-01 2.72E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.61E-01 -4.37E-02 -2.54E-01
Olive pollen allergy CA08.00 Peripheral blood 6.28E-01 -1.54E-01 -3.42E-01
Oral cancer 2B6E Oral tissue 2.06E-03 5.07E-01 6.95E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.48E-02 4.15E-01 1.00E+00
Osteoporosis FB83.1 Bone marrow 5.19E-01 9.99E-02 3.27E-01
Ovarian cancer 2C73 Ovarian tissue 3.39E-02 5.67E-01 9.41E-01
Pancreatic cancer 2C10 Pancreas 5.46E-01 1.10E-02 3.36E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 7.56E-01 -2.65E-01 -5.24E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.40E-01 -5.36E-02 -2.53E-01
Pituitary cancer 2D12 Pituitary tissue 4.42E-02 3.60E-01 7.65E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.37E-01 3.01E-01 1.20E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.13E-01 -1.05E-01 -3.95E-01
Polycythemia vera 2A20.4 Whole blood 6.10E-16 -5.30E-01 -1.94E+00
Pompe disease 5C51.3 Biceps muscle 3.45E-01 -8.44E-02 -4.21E-01
Preterm birth KA21.4Z Myometrium 3.51E-01 -4.07E-01 -7.43E-01
Prostate cancer 2C82 Prostate 9.34E-06 1.35E+00 1.34E+00
Psoriasis EA90 Skin 2.44E-10 3.12E-01 6.13E-01
Rectal cancer 2B92 Rectal colon tissue 3.29E-01 1.83E-01 8.76E-01
Renal cancer 2C90-2C91 Kidney 3.01E-02 3.81E-01 5.37E-01
Retinoblastoma 2D02.2 Uvea 3.31E-01 1.63E-01 5.31E-01
Rheumatoid arthritis FA20 Synovial tissue 2.50E-05 6.10E-01 2.82E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.91E-01 -2.84E-03 -1.75E-02
Schizophrenia 6A20 Prefrontal cortex 4.62E-01 -9.23E-02 -1.52E-01
Schizophrenia 6A20 Superior temporal cortex 7.90E-01 2.18E-02 8.93E-02
Scleroderma 4A42.Z Whole blood 3.66E-02 1.15E-01 6.04E-01
Seizure 8A60-8A6Z Whole blood 3.82E-01 8.97E-03 2.61E-02
Sensitive skin EK0Z Skin 7.17E-01 3.58E-01 8.68E-01
Sepsis with septic shock 1G41 Whole blood 2.08E-14 -4.73E-01 -1.03E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.94E-01 -7.15E-02 -1.68E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.54E-01 1.30E-02 2.18E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 9.11E-01 9.06E-02 5.69E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.00E-01 -2.32E-01 -6.24E-01
Skin cancer 2C30-2C3Z Skin 9.54E-12 3.80E-01 6.52E-01
Thrombocythemia 3B63 Whole blood 1.29E-09 -4.16E-01 -1.97E+00
Thrombocytopenia 3B64 Whole blood 5.65E-01 -6.21E-01 -4.86E-01
Thyroid cancer 2D10 Thyroid 2.50E-09 -3.44E-01 -7.62E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.42E-03 1.87E-01 4.51E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.61E-02 -1.59E-01 -9.93E-01
Type 2 diabetes 5A11 Liver tissue 1.57E-01 2.33E-01 1.20E+00
Ureter cancer 2C92 Urothelium 3.85E-01 1.93E-02 9.84E-02
Uterine cancer 2C78 Endometrium tissue 6.41E-03 1.37E-01 2.61E-01
Vitiligo ED63.0 Skin 2.19E-01 -4.32E-02 -3.76E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Altered expression of two zinc transporters, SLC30A5 and SLC30A6, underlies a mammary gland disorder of reduced zinc secretion into milk. Genes Nutr. 2015 Sep;10(5):487.