Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1EPXZ)
| DTT Name | Interleukin-24 (IL24) | ||||
|---|---|---|---|---|---|
| Synonyms | Suppression of tumorigenicity 16 protein; ST16; Melanoma differentiationassociated gene 7 protein; Melanoma differentiation-associated gene 7 protein; MDA7; MDA-7; Interleukin24; IL-24 | ||||
| Gene Name | IL24 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL DVEAALTKALGEVDILLTWMQKFYKL |
||||
| Function | Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
