Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1EPXZ)
| DTT Name | Interleukin-24 (IL24) | ||||
|---|---|---|---|---|---|
| Synonyms | Suppression of tumorigenicity 16 protein; ST16; Melanoma differentiationassociated gene 7 protein; Melanoma differentiation-associated gene 7 protein; MDA7; MDA-7; Interleukin24; IL-24 | ||||
| Gene Name | IL24 | ||||
| DTT Type | 
                     Clinical trial target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Cytokine: interleukin 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ 
                        
                    VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL DVEAALTKALGEVDILLTWMQKFYKL  | 
            ||||
| Function | Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Clinical Trial Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
