Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1HYOF)
| DTT Name | Bacterial Shiga toxin 2 subunit B (Bact stxII) | ||||
|---|---|---|---|---|---|
| Synonyms |
Stx2B protein; Stx2B; Stx2 holotoxin subunit B; Stx2 holotoxin B subunit; Shiga-like toxin type II B subunit; Shiga toxin subunit B; Shiga toxin 2v subunit A; Shiga toxin 2B; Shiga toxin 2, subunit B; Shiga toxin 2 B subunit
|
||||
| Gene Name | Bact stxII | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| Sequence |
MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND |
||||
| Function | Shiga toxin, one of the most potent bacterial toxins known. Binds to the cellular receptor, globotriaosylceramide, Gb3, found primarily on endothelial cells. | ||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||