Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1MHKD)
| DTT Name | Protein tyrosine phosphatase IVA 2 (PRL-2) | ||||
|---|---|---|---|---|---|
| Synonyms | Protein-tyrosine phosphatase of regenerating liver 2; Protein-tyrosine phosphatase 4a2; Protein tyrosine phosphatase type IVA 2; PTPCAAX2; PTP(CAAXII); PRL2; OV-1; HU-PP-1; BM-008 | ||||
| Gene Name | PTP4A2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Phosphoric monoester hydrolase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 3.1.3.48
|
||||
| Sequence |
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGI
HVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECG MKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ |
||||
| Function |
Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis.
|
||||
| Reactome Pathway | |||||