Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1S4LJ)
| DTT Name | RRM2 messenger RNA (RRM2 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | Ribonucleotide reductase small subunit (mRNA); Ribonucleotide reductase small chain (mRNA); Ribonucleoside-diphosphate reductase subunit M2 (mRNA); RR2 (mRNA) | ||||
| Gene Name | RRM2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 1.17.4.1
|
||||
| Sequence |
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN FFEKRVGEYQRMGVMSSPTENSFTLDADF |
||||
| Function | Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. Provides the precursors necessary for DNA synthesis. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||
