Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1W3RE)
| DTT Name | Mammaglobin A (SCGB2A2) | ||||
|---|---|---|---|---|---|
| Synonyms | UGB2; Secretoglobin family 2A member 2; Mammaglobin-A; Mammaglobin-1; MGB1 | ||||
| Gene Name | SCGB2A2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Secretoglobin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID
ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
||||
| Function | Expressed mainly in mucosa. Involved in cell signalling, immune response, and chemotaxis, and may also serve as transporters for steroid hormones in humans. | ||||