Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2IYXF)

• DTT Name: L-selectin (SELL)
• Synonyms: TQ1; SELL; Lymph node homing receptor; Leukocyte-endothelial cell adhesion molecule 1; Leukocyte surface antigen Leu-8; Leukocyte adhesion molecule-1; LECAM1; LAM-1; Gp90-MEL; CD62L
• Gene Name: SELL
• DTT Type: Clinical trial target; [1]
• UniProt ID: LYAM1_HUMAN
• TTD ID: T60526
• Sequence:
  MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
  YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN
  NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC
  NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT
  CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
  TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
  GKKSKRSMNDPY
• Function: Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
• KEGG Pathway: Cell adhesion molecules (CAMs) (hsa04514)
• Reactome Pathway:
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GMI-1070	DMJ432G	Asthma	CA23	Phase 3	[1]
BAICALEIN	DM4C7E6	Influenza virus infection	1E30-1E32	Phase 2	[2]

2 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Hu Dreg 55	DMK1VHF	Psoriasis vulgaris	EA90	Terminated	[3]
PURPUROGALLIN	DM63O4F	N. A.	N. A.	Terminated	[2]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2,3,4-trihydroxybenzoic acid	DMWHK35	Discovery agent	N.A.	Investigative	[2]
LD201t1	DMC5XQ6	Inflammation	1A00-CA43.1	Investigative	[4]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	3.40E-07	2.19	1.02
Psoriasis	EA90	Skin	1.86E-36	1.26	2.55

References

• [1] Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890.
• [2] Rational design of novel, potent small molecule pan-selectin antagonists. J Med Chem. 2007 Mar 22;50(6):1101-15.
• [3] Clinical pipeline report, company report or official report of glycomimetics.
• [4] Therapeutic applications of aptamers. Expert Opin Investig Drugs. 2008 Jan;17(1):43-60.