Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2Z39D)

• DTT Name: Thyrotropin-releasing hormone (TRH)
• Synonyms: Prothyroliberin; Pro-thyrotropin-releasing hormone; Pro-TRH
• Gene Name: TRH
• DTT Type: Clinical trial target; [1]
• UniProt ID: TRH_HUMAN
• TTD ID: T58920
• Sequence:
  MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQ
  RLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRRE
  DEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDL
  MPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
  EE
• Function: As a component of the hypothalamic-pituitary-thyroid axis, it controls the secretion of thyroid-stimulating hormone (TSH) and is involved in thyroid hormone synthesis regulation. It also operates as modulator of hair growth. It promotes hair-shaft elongation, prolongs the hair cycle growth phase (anagen) and antagonizes its termination (catagen) by TGFB2. It stimulates proliferation and inhibits apoptosis of hair matrix keratinocytes.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
KPS-0373	DMP5G1K	Parkinson disease	8A00.0	Phase 3	[1]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RX-77368	DMR0K85	Dementia	6D80-6D86	Discontinued in Phase 2	[2]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Parkinson's disease	8A00.0	Substantia nigra tissue	2.52E-01	0.09	0.49

References

• [1] DOI: 10.1002/mdc3.12057
• [2] Intracisternal urocortin inhibits vagally stimulated gastric motility in rats: role of CRF(2).Br J Pharmacol.2002 May;136(2):237-47.