Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT369WU)
| DTT Name | Stathmin-1 (STMN1) | ||||
|---|---|---|---|---|---|
| Synonyms | pp19; pp17; Stathmin; Protein Pr22; Prosolin; Phosphoprotein p19; Oncoprotein 18; OP18; Metablastin; Leukemia-associated phosphoprotein p18; LAP18; C1orf215 | ||||
| Gene Name | STMN1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL ERLREKDKHIEEVRKNKESKDPADETEAD |
||||
| Function |
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||