| DTT Name |
TGFB1 messenger RNA (TGFB1 mRNA)
|
| Synonyms |
Transforming growth factor beta-1 proprotein (mRNA); Transforming growth factor beta-1 (mRNA); TGFB (mRNA); TGF-beta1 (mRNA); TGF-beta 1 (mRNA) |
| Gene Name |
TGFB1
|
| DTT Type |
Literature-reported target
|
[1] |
| BioChemical Class |
mRNA target
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
|
| Function |
Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively.
|
| KEGG Pathway |
- MAPK signaling pathway (hsa04010 )
- Cytokine-cytokine receptor interaction (hsa04060 )
- FoxO signaling pathway (hsa04068 )
- Cell cycle (hsa04110 )
- Cellular senescence (hsa04218 )
- TGF-beta signaling pathway (hsa04350 )
- Osteoclast differentiation (hsa04380 )
- Hippo signaling pathway (hsa04390 )
- Th17 cell differentiation (hsa04659 )
- Intestinal immune network for IgA production (hsa04672 )
- Relaxin signaling pathway (hsa04926 )
- Non-alcoholic fatty liver disease (hsa04932 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Leishmaniasis (hsa05140 )
- Chagas disease (hsa05142 )
- Malaria (hsa05144 )
- Toxoplasmosis (hsa05145 )
- Amoebiasis (hsa05146 )
- Tuberculosis (hsa05152 )
- Hepatitis B (hsa05161 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Pathways in cancer (hsa05200 )
- Proteoglycans in cancer (hsa05205 )
- Colorectal cancer (hsa05210 )
- Renal cell carcinoma (hsa05211 )
- Pancreatic cancer (hsa05212 )
- Chronic myeloid leukemia (hsa05220 )
- Hepatocellular carcinoma (hsa05225 )
- Gastric cancer (hsa05226 )
- Inflammatory bowel disease (hsa05321 )
- Rheumatoid arthritis (hsa05323 )
- Hypertrophic cardiomyopathy (hsa05410 )
- Dilated cardiomyopathy (hsa05414 )
- Diabetic cardiomyopathy (hsa05415 )
|
| Reactome Pathway |
- Influenza Virus Induced Apoptosis (R-HSA-168277 )
- Cell surface interactions at the vascular wall (R-HSA-202733 )
- Molecules associated with elastic fibres (R-HSA-2129379 )
- Downregulation of TGF-beta receptor signaling (R-HSA-2173788 )
- TGF-beta receptor signaling activates SMADs (R-HSA-2173789 )
- TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) (R-HSA-2173791 )
- Syndecan interactions (R-HSA-3000170 )
- ECM proteoglycans (R-HSA-3000178 )
- SMAD2/3 Phosphorylation Motif Mutants in Cancer (R-HSA-3304356 )
- TGFBR2 MSI Frameshift Mutants in Cancer (R-HSA-3642279 )
- TGFBR2 Kinase Domain Mutants in Cancer (R-HSA-3645790 )
- TGFBR1 KD Mutants in Cancer (R-HSA-3656532 )
- TGFBR1 LBD Mutants in Cancer (R-HSA-3656535 )
- Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
- UCH proteinases (R-HSA-5689603 )
- Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
- RUNX3 regulates CDKN1A transcription (R-HSA-8941855 )
- Regulation of RUNX3 expression and activity (R-HSA-8941858 )
- RUNX3 regulates p14-ARF (R-HSA-8951936 )
- Platelet degranulation (R-HSA-114608 )
|
|
|
|
|
|
|