Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT3C8EG)

• DTT Name: Junctional adhesion molecule A (F11R)
• Synonyms: Platelet adhesion molecule 1; Platelet F11 receptor; PAM-1; Junctional adhesion molecule 1; JCAM; JAM1; JAM-A; JAM-1; CD321
• Gene Name: F11R
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Immunoglobulin
• UniProt ID: JAM1_HUMAN
• TTD ID: T15438
• Sequence:
  MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
  EWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYG
  EVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST
  RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
  AAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
• Function: Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly (By similarity). Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier (By similarity). Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation.
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  Tight junction (hsa04530)
  Leukocyte transendothelial migration (hsa04670)
  Epithelial cell signaling in Helicobacter pylori infection (hsa05120)
• Reactome Pathway:
  Integrin cell surface interactions (R-HSA-216083)
  TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) (R-HSA-2173791)
  Tight junction interactions (R-HSA-420029)
  Cell surface interactions at the vascular wall (R-HSA-202733)

References

• [1] Junctional Adhesion Molecule-A in Head and Neck Squamous Cell Carcinoma. Adv Otorhinolaryngol. 2016;77:92-7.