| DTT Name |
HUMAN interleukin 8 (IL8)
|
| Synonyms |
T-cell chemotactic factor; Protein 3-10C; Neutrophil-activating protein 1; NAP-1; Monocyte-derived neutrophil-activating peptide; Monocyte-derived neutrophil chemotactic factor; MONAP; MDNCF; IL8; IL-8; Granulocyte chemotactic protein 1; GCP-1; Emoctakin; Chemokine (C-X-C motif) ligand 8; C-X-C motif chemokine 8
|
| Gene Name |
CXCL8
|
| BioChemical Class |
Cytokine: interleukin
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
|
| Function |
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
|
| KEGG Pathway |
- Cytokine-cytokine receptor interaction (hsa04060 )
- Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
- Chemokine signaling pathway (hsa04062 )
- NF-kappa B signaling pathway (hsa04064 )
- Phospholipase D signaling pathway (hsa04072 )
- Cellular senescence (hsa04218 )
- Toll-like receptor signaling pathway (hsa04620 )
- NOD-like receptor signaling pathway (hsa04621 )
- RIG-I-like receptor signaling pathway (hsa04622 )
- IL-17 signaling pathway (hsa04657 )
- Non-alcoholic fatty liver disease (hsa04932 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Alcoholic liver disease (hsa04936 )
- Epithelial cell signaling in Helicobacter pylori infection (hsa05120 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Shigellosis (hsa05131 )
- Salmonella infection (hsa05132 )
- Pertussis (hsa05133 )
- Legionellosis (hsa05134 )
- Yersinia infection (hsa05135 )
- Chagas disease (hsa05142 )
- Malaria (hsa05144 )
- Amoebiasis (hsa05146 )
- Hepatitis B (hsa05161 )
- Human cytomegalovirus infection (hsa05163 )
- Influenza A (hsa05164 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Coronavirus disease - COVID-19 (hsa05171 )
- Pathways in cancer (hsa05200 )
- Transcriptional misregulation in cancer (hsa05202 )
- Bladder cancer (hsa05219 )
- Rheumatoid arthritis (hsa05323 )
- Lipid and atherosclerosis (hsa05417 )
|
| Reactome Pathway |
- Peptide ligand-binding receptors (R-HSA-375276 )
- Chemokine receptors bind chemokines (R-HSA-380108 )
- ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994 )
- G alpha (i) signalling events (R-HSA-418594 )
- Interleukin-10 signaling (R-HSA-6783783 )
- Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
- Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
|
|
|
|
|
|
|
