Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT4F7SL)

DTT Name	Gap junction alpha-1 protein (GJA1)
Synonyms	Gap junction 43 kDa heart protein; GJAL; Cx43; Connexin-43; Connexin 43
Gene Name	GJA1
DTT Type	Clinical trial target	[1]
BioChemical Class	Gap junction-forming connexin
UniProt ID	CXA1_HUMAN
TTD ID	T44479
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG VNVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFS LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV KGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD QRPSSRASSRASSRPRPDDLEI
Function	A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles. Gap junction protein that acts as a regulator of bladder capacity.
KEGG Pathway	Gap junction (hsa04540 ) Arrhythmogenic right ventricular cardiomyopathy (ARVC) (hsa05412 )
Reactome Pathway	Gap junction assembly (R-HSA-190861 ) Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane (R-HSA-190840 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Act1	DMXYRPO	Wound healing	EL8Y	Phase 3	[1]
Granexin gel	DMZS2R7	Diabetic foot ulcer	BD54	Phase 3	[2]
HCB1019	DMX8C6J	Diabetic macular edema	9B71.02	Phase 2	[3]
ALMB-0168	DMB0LSF	Osteosarcoma	2B51	Phase 1/2	[4]
ALMB-0166	DM3MH2H	Spinal cord injury	ND51.2	Phase 1	[5]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
octanol	DMBGHPE	Discovery agent	N.A.	Investigative	[6]
------------------------------------------------------------------------------------

References

1	Company report (FirstString Research)
2	Antibodies and venom peptides: new modalities for ion channels. Nat Rev Drug Discov. 2019 May;18(5):339-357.
3	Clinical pipeline report, company report or official report of OcuNexus Therapeutics.
4	Clinical pipeline report, company report or official report of AlaMab Therapeutics
5	Clinical pipeline report, company report or official report of AlaMab Therapeutics
6	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 728).