Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT4L35O)
| DTT Name | Apolipoprotein C-III (ApoCIII) | ||||
|---|---|---|---|---|---|
| Synonyms | Apolipoprotein CIII; Apolipoprotein C3; ApoC-III; Apo-CIII | ||||
| Gene Name | APOC3 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Apolipoprotein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
||||
| Function |
Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
