Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT4PTJ7)
| DTT Name | Ribonuclease P protein (RPP) | ||||
|---|---|---|---|---|---|
| Synonyms | Ribonuclease P protein | ||||
| Gene Name | RPP14 | ||||
| DTT Type |
Discontinued target
|
[1] | |||
| BioChemical Class |
Endoribonucleases
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALP
LDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRE LVLD |
||||
| Function | Acts as a catalyst in the same way that a protein-based enzyme would. Its function is to cleave off an extra, or precursor, sequence of RNA on tRNA molecules. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
