Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT4YO0Z)

• DTT Name: Phosphopantetheine adenylyltransferase (PPAT)
• Synonyms: Pantetheine-phosphate adenylyltransferase; Dephospho-CoA pyrophosphorylase; COASY
• Gene Name: COASY
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Kinase
• UniProt ID: COASY_HUMAN
• TTD ID: T98179
• EC Number: EC 2.7.7.3
• Sequence:
  VAGSPKQPVRGYYRGAVGGTFDRLHNAHKVLLSVACILAQEQLVVGVADKDLLKSKLLPE
  LLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDPSLEFLVVSEETYRGGMAIN
  RFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELPTCL
• Function: Bifunctional enzyme that catalyzes the fourth and fifth sequential steps of CoA biosynthetic pathway. The fourth reaction is catalyzed by the phosphopantetheine adenylyltransferase, coded by the coaD domain; the fifth reaction is catalyzed by the dephospho-CoA kinase, coded by the coaE domain. May act as a point of CoA biosynthesis regulation.
• KEGG Pathway:
  Pantothenate and CoA biosynthesis (hsa00770)
  Metabolic pathways (hsa01100)

Molecular Interaction Atlas (MIA) of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PTX-007011	DM89RT7	Bacterial infection	1A00-1C4Z	Terminated	[1]

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-Methyl-2,4-Pentanediol	DMD45CU	Discovery agent	N.A.	Investigative	[2]
4'-Phosphopantetheine	DMJ0A4Z	Discovery agent	N.A.	Investigative	[2]
Coenzyme A	DM1I8LU	Discovery agent	N.A.	Investigative	[2]
Dephospho Coenzyme A	DMGHM1L	Discovery agent	N.A.	Investigative	[3]

References

• [1] NME DIGEST. Drug News & Perspect 2002, 15(8):519, ISSN 0214-0934.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [3] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.