Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT53XHB)
| DTT Name | CD86 messenger RNA (CD86 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | T-lymphocyte activation antigen CD86 (mRNA); FUN-1 (mRNA); CTLA-4 counter-receptor B7.2 (mRNA); CD86 (mRNA); CD28LG2 (mRNA); BU63 (mRNA); B70 (mRNA); Activation B7-2 antigen (mRNA) | ||||
| Gene Name | CD86 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK IHIPERSDEAQRVFKSSKTSSCDKSDTCF |
||||
| Function |
May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
4 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||
