Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT53XHB)

DTT Name	CD86 messenger RNA (CD86 mRNA)
Synonyms	T-lymphocyte activation antigen CD86 (mRNA); FUN-1 (mRNA); CTLA-4 counter-receptor B7.2 (mRNA); CD86 (mRNA); CD28LG2 (mRNA); BU63 (mRNA); B70 (mRNA); Activation B7-2 antigen (mRNA)
Gene Name	CD86
DTT Type	Literature-reported target	[1]
BioChemical Class	mRNA target
UniProt ID	CD86_HUMAN
TTD ID	T97783
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK IHIPERSDEAQRVFKSSKTSSCDKSDTCF
Function	May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4.
KEGG Pathway	Cell adhesion molecules (CAMs) (hsa04514 ) Toll-like receptor signaling pathway (hsa04620 ) Intestinal immune network for IgA production (hsa04672 ) Type I diabetes mellitus (hsa04940 ) Transcriptional misregulation in cancer (hsa05202 ) Autoimmune thyroid disease (hsa05320 ) Systemic lupus erythematosus (hsa05322 ) Rheumatoid arthritis (hsa05323 ) Allograft rejection (hsa05330 ) Graft-versus-host disease (hsa05332 ) Viral myocarditis (hsa05416 )
Reactome Pathway	Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 ) CD28 co-stimulation (R-HSA-389356 ) CD28 dependent PI3K/Akt signaling (R-HSA-389357 ) CD28 dependent Vav1 pathway (R-HSA-389359 ) CTLA4 inhibitory signaling (R-HSA-389513 ) PIP3 activates AKT signaling (R-HSA-1257604 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 10373	DM60CBI	Discovery agent	N.A.	Investigative	[1]
ISIS 113131	DM063XM	Discovery agent	N.A.	Investigative	[2]
ISIS 9133	DMDKB1I	Discovery agent	N.A.	Investigative	[1]
ISIS 9139	DMGOPHN	Discovery agent	N.A.	Investigative	[1]
------------------------------------------------------------------------------------

References

1	US patent application no. 6,319,906, Oligonucleotide compositions and methods for the modulation of the expression of B7 protein.
2	US patent application no. 7,425,545, Modulation of C-reactive protein expression.