Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT5D314)
| DTT Name | Lipophilin-B (SCGB1D2) | ||||
|---|---|---|---|---|---|
| Synonyms | Secretoglobin family 1D member 2; SCGB1D2 | ||||
| Gene Name | SCGB1D2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Secretoglobin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKL
GVKRCTDQMSLQKRSLIAEVLVKILKKCSV |
||||
| Function | May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones. | ||||